KEGG   Bacillus subtilis subsp. subtilis 168: BSU16470
Entry
BSU16470          CDS       T00010                                 

Symbol
sigD
Name
(RefSeq) RNA polymerase sigma-D factor
  KO
K02405  RNA polymerase sigma factor FliA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU16470 (sigD)
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16470 (sigD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU16470 (sigD)
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16470 (sigD)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU16470 (sigD)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Stator
    BSU16470 (sigD)
SSDB
Motif
Pfam: Sigma70_r4 Sigma70_r2 Sigma70_r3 Sigma70_r4_2 HTH_23 UPF0122 HTH_38 UPF0175 IF2_N
Other DBs
NCBI-GeneID: 938482
NCBI-ProteinID: NP_389529
Pasteur: BG10751
BSORF: BG10751
UniProt: P10726 A0A6M4JI85
Position
1716493..1717257
AA seq 254 aa
MQSLNYEDQVLWTRWKEWKDPKAGDDLMRRYMPLVTYHVGRISVGLPKSVHKDDLMSLGM
LGLYDALEKFDPSRDLKFDTYASFRIRGAIIDGLRKEDWLPRTSREKTKKVEAAIEKLEQ
RYLRNVSPAEIAEELGMTVQDVVSTMNEGFFANLLSIDEKLHDQDDGENIQVMIRDDKNV
PPEEKIMKDELIAQLAEKIHELSEKEQLVVSLFYKEELTLTEIGQVLNLSTSRISQIHSK
ALFKLKNLLEKVIQ
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcaatccttgaattatgaagatcaggtgctttggacgcgctggaaagagtggaaagat
cctaaagccggtgacgacttaatgcgccgttacatgccgcttgtcacatatcatgtaggc
agaatttctgtcggactgccgaaatcagtgcataaagacgatcttatgagccttggtatg
cttggtttatatgatgcccttgaaaaatttgaccccagccgggacttaaaatttgatacc
tacgcctcgtttagaattcgcggcgcaatcatagacgggcttcgtaaagaagattggctg
cccagaacctcgcgcgaaaaaacaaaaaaggttgaagcagcaattgaaaagcttgaacag
cggtatcttcggaatgtatcgcccgcggaaattgcagaggaactcggaatgacggtacag
gatgtcgtgtcaacaatgaatgaaggtttttttgcaaatctgctgtcaattgatgaaaag
ctccatgatcaagatgacggggaaaacattcaagtcatgatcagagatgacaaaaatgtt
ccgcctgaagaaaagattatgaaggatgaactgattgcacagcttgcggaaaaaattcac
gaactctctgaaaaagaacagctggttgtcagtttgttctacaaagaggagttgacactg
acagaaatcggacaagtattaaatctttctacgtcccgcatatctcagatccattcaaag
gcattatttaaattaaagaatctgctggaaaaagtgatacaataa

DBGET integrated database retrieval system