KEGG   Bacillus subtilis subsp. subtilis 168: BSU16670
Entry
BSU16670          CDS       T00010                                 

Symbol
ribC
Name
(RefSeq) riboflavin biosynthesis protein RibC
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00740  Riboflavin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSU16670 (ribC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     BSU16670 (ribC)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthase
     BSU16670 (ribC)
SSDB
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like
Other DBs
NCBI-GeneID: 938110
NCBI-ProteinID: NP_389549
Pasteur: BG11495
BSORF: BG11495
UniProt: P54575 A0A6M3ZAW2
Position
1737834..1738784
AA seq 316 aa
MKTIHITHPHHLIKEEQAKSVMALGYFDGVHLGHQKVIGTAKQIAEEKGLTLAVMTFHPH
PSHVLGRDKEPKDLITPLEDKINQIEQLGTEVLYVVKFNEVFASLSPKQFIDQYIIGLNV
QHAVAGFDFTYGKYGKGTMKTMPDDLDGKAGCTMVEKLTEQDKKISSSYIRTALQNGDVE
LANVLLGQPYFIKGIVIHGDKRGRTIGFPTANVGLNNSYIVPPTGVYAVKAEVNGEVYNG
VCNIGYKPTFYEKRPEQPSIEVNLFDFNQEVYGAAIKIEWYKRIRSERKFNGIKELTEQI
EKDKQEAIRYFSNLRK
NT seq 951 nt   +upstreamnt  +downstreamnt
gtgaagacgatacatattacacatcctcatcatttaataaaagaggagcaggcaaaatca
gtgatggcgttaggttattttgacggcgttcatctcgggcatcaaaaggtaatcggcaca
gcgaagcaaatagccgaagaaaaaggtctgacattagctgtgatgacctttcatccccat
ccttctcacgtgttgggcagagataaggaaccaaaggatctgattacgcctcttgaagac
aaaataaaccaaattgaacaattaggcacagaagttctgtatgtcgttaaatttaatgaa
gtgtttgcttctctttctcctaagcagtttatagaccagtatattatcggccttaatgtg
cagcacgcagtggcaggctttgactttacgtacggcaaatacggcaagggaacaatgaag
accatgccggatgatttagacggaaaagctgggtgcacaatggtagaaaaattaacggag
caggataaaaaaatcagttcttcgtatatccgtaccgcgcttcaaaacggagatgttgaa
ttggcgaatgtcttgcttggacaaccttattttattaaaggaattgtcattcatggtgat
aaaagagggcggaccatcgggtttccgacagcgaatgtcggtttaaataacagctatatc
gttccgcccacaggtgtatatgccgtaaaagcggaagtgaacggcgaagtttacaatggc
gtttgcaatattggctataagccaacgttttatgaaaagcgccctgaacagccttccatc
gaggtcaatctgtttgatttcaatcaagaggtatatggagccgctataaaaatcgaatgg
tacaaacggattcggagcgagcggaaattcaatggcatcaaagaattaactgagcaaatt
gagaaagataagcaggaagccatccgttatttcagcaatttgcggaaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU29300
Entry
BSU29300          CDS       T00010                                 

Symbol
rbfK
Name
(RefSeq) RNA-binding riboflavin kinase RibR
  KO
K00861  riboflavin kinase [EC:2.7.1.26]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00740  Riboflavin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSU29300 (rbfK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     BSU29300 (rbfK)
SSDB
Motif
Pfam: Flavokinase
Other DBs
NCBI-GeneID: 937367
NCBI-ProteinID: NP_390808
Pasteur: BG11969
BSORF: BG11969
UniProt: P94465 A0A6M4JML8
Position
complement(3000985..3001677)
AA seq 230 aa
MTIIAGTVVKGKQLGRKLGFPTANVDAKIHGLRNGVYGVLATVNHQFHLGVMNIGVKPTV
GSNLEKTLEIFLFDFHRDIYGEKIECSILFKIREERRFDSLESLTKQIKKDISCVAKRFE
LIGIMAPNKKESLLSHQELNLPDLCFYKKCNNLYGVNRGVYNVIDNWFFEYGITQVAYRR
IYILSFLSFLKEDNPKVSSKYIRFGAGGLADKLNRFISSYVEESEENILG
NT seq 693 nt   +upstreamnt  +downstreamnt
ttgacgatcattgccggtacggttgtgaaaggaaaacaattaggcagaaagcttggattc
cccacggcaaatgtagatgcaaaaatacatgggctgcgtaatggagtttatggggttctg
gcgacagtcaatcatcaatttcatttaggggttatgaatatcggtgtgaaaccgacggtg
ggctctaaccttgaaaagacattggagatttttttgtttgactttcatagagacatttat
ggagaaaaaatcgaatgcagcattctctttaaaattagagaagaaagaaggtttgattct
ttggagtctttaacaaagcaaattaaaaaggatatttcgtgcgttgcaaaacgctttgag
ctgattgggattatggcaccaaacaaaaaagaaagccttctttcccatcaggagttaaat
cttccggatctctgcttttacaagaaatgtaataacctatatggcgtcaaccgaggcgta
tacaatgtcattgataactggttttttgagtacggaattacacaagtagcttacaggcgc
atttatattttatcttttttaagctttttgaaagaagataatccgaaagtttccagcaag
tatataagatttggggcgggcggtcttgctgataaattgaaccgatttatttcatcttat
gttgaagagtctgaagaaaatatattgggatag

DBGET integrated database retrieval system