KEGG   Bacillus subtilis subsp. subtilis 168: BSU16680
Entry
BSU16680          CDS       T00010                                 

Symbol
rpsO
Name
(RefSeq) 30S ribosomal protein S15
  KO
K02956  small subunit ribosomal protein S15
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU16680 (rpsO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU16680 (rpsO)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU16680 (rpsO)
  Bacteria
    BSU16680 (rpsO)
  Archaea
    BSU16680 (rpsO)
SSDB
Motif
Pfam: Ribosomal_S15
Other DBs
NCBI-GeneID: 938814
NCBI-ProteinID: NP_389550
Pasteur: BG19010
BSORF: BG19010
UniProt: P21473 A0A6M4JK50
Position
1738941..1739210
AA seq 89 aa
MAITQERKNQLINEFKTHESDTGSPEVQIAILTDSINNLNEHLRTHKKDHHSRRGLLKMV
GKRRNLLTYLRNKDVTRYRELINKLGLRR
NT seq 270 nt   +upstreamnt  +downstreamnt
atggcaattactcaagagcgtaaaaaccaactcatcaatgagttcaaaacacacgaatct
gatactggatctccagaagttcagatcgctatcctaactgactcaattaacaacttgaac
gagcatttacgtactcacaagaaagaccaccactcacgtcgcggtcttcttaaaatggta
ggtaagcgtcgtaatcttcttacgtatctgcgtaataaagacgtaactcgttaccgtgag
ttaattaacaaactaggcttacgtcgataa

DBGET integrated database retrieval system