KEGG   Bacillus subtilis subsp. subtilis 168: BSU17040
Entry
BSU17040          CDS       T00010                                 

Symbol
mutS
Name
(RefSeq) DNA mismatch repair protein MutS
  KO
K03555  DNA mismatch repair protein MutS
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    BSU17040 (mutS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU17040 (mutS)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     BSU17040 (mutS)
SSDB
Motif
Pfam: MutS_V MutS_I MutS_III MutS_IV MutS_II AAA_14 FdhE Rad17 AAA_29 YPEB Med3 RXLR_WY AAA_23
Other DBs
NCBI-GeneID: 939501
NCBI-ProteinID: NP_389586
Pasteur: BG11403
BSORF: BG11403
UniProt: P49849 A0A6M3ZB00
Position
1775745..1778321
AA seq 858 aa
MAGYTPMIQQYLKIKAEHQDAFLFFRLGDFYEMFFEDAKKASQELEITLTSRDGGAAEKI
PMCGVPYHSASAYIEQLIKKGYKVAICEQTEDPKAAKGVVKREVVQLITPGTVMDGKGIH
ESENNFIASVSACSNGYGLALSDLTTGENLAVLIERLEDVISEIYSVGAREIVVSGSLDA
DTVAQLRERCGATISIEDGETDEHVTIIEHLNNEDITKTFLRLYTYLKRTQKRSLDHLQP
VQVYELEEAMKIDLYSKRNLELTETIRSKNKKGSLLWLLDETKTAMGGRLLKQWIDRPLI
RVNQIEERQEMVETLMSHFFEREDLRERLKEVYDLERLAGRVAFGNVNARDLIQLKESLK
QVPGIKQLVASLAHDKAKERAKRIDPCGDVLELLEEALYENPPLSVKEGNLIKDGYNQKL
DEYRDASRNGKDWIARLEQQEREYTGIRSLKVGFNKVFGYYIEVTKANLHLLEEGRYERK
QTLTNAERYITPELKEKEALILEAENNICELEYELFTELREKVKQYIPRLQQLAKQMSEL
DALQCFATISENRHYTKPEFSKDEVEVIEGRHPVVEKVMDSQEYVPNNCMMGDNRQMLLI
TGPNMSGKSTYMRQIALISIMAQIGCFVPAKKAVLPIFDQIFTRIGAADDLISGQSTFMV
EMLEAKNAIVNATKNSLILFDEIGRGTSTYDGMALAQAIIEYVHDHIGAKTLFSTHYHEL
TVLEDKLPQLKNVHVRAEEYNGTVVFLHQIKEGAADKSYGIHVAQLAELPGDLIARAQDI
LKELEHSGNKPEVPVQKPQVKEEPAQLSFFDEAEKPAETPKLSKKEKQVIDAFKSLNILD
MTPLEAMNEMYKLQKKLH
NT seq 2577 nt   +upstreamnt  +downstreamnt
atggccggttatacgcctatgatacagcaatatttaaaaataaaggcagagcaccaggat
gcctttttattttttcgcctgggtgatttttatgaaatgttttttgaggacgccaaaaaa
gcgtcacaagagctggaaattacgttaacgagcagagacggcggtgcggctgaaaaaata
ccgatgtgcggtgtgccgtatcattctgcttccgcgtatatcgaacagcttattaaaaaa
ggatacaaagtggcgatctgtgaacagacggaagatccgaaagccgcaaagggcgttgtg
aaaagagaagtagttcagctgattacgcccggaactgtaatggacggcaaaggcatccat
gagtcggaaaataattttatcgcatctgtttcagcctgctcgaacggatacggacttgct
ctgtctgatttaacaacgggagaaaatttggctgttttgattgaacggcttgaagacgtc
atatcagaaatttattcagtcggcgcacgggaaatcgtggtttcaggaagcttggatgcc
gatacagtggcacagctgagagagcggtgcggtgcaacgatttcaattgaagacggagaa
acagacgaacacgtaacgatcattgagcacttaaataatgaagatataacaaaaacattt
ctgcgcttatatacgtatttgaaaagaacccaaaagcgcagccttgatcatcttcagccc
gtgcaggtgtatgagcttgaggaagcgatgaaaattgacttgtactcaaagcgtaatctg
gagctgaccgaaacgattcgttcgaaaaataaaaaaggctcccttttgtggctgctggat
gaaacaaaaacggcaatgggaggccggctacttaaacagtggattgaccggccgcttatc
agagtcaatcaaatcgaagagcgccaagaaatggtggaaacattaatgtcccatttcttt
gaacgggaagatctgcgtgaacgtttaaaagaagtatatgacttagaacgccttgccggc
cgcgttgcattcggaaatgtcaatgcccgggatttgattcagctgaaggaatcgttaaag
caagtgcctggcatcaaacagctggttgcttcactggctcatgacaaggccaaggaacgt
gcaaagcgcattgacccttgcggggatgtacttgaactgctggaagaagcgctgtacgaa
aaccctcctttatcggtaaaagaagggaacctgattaaagatggttataatcaaaagctt
gatgaatatcgtgatgcaagcagaaacggaaaagactggattgcccgcctggaacagcag
gagcgggaatacacaggcattcgctctttaaaggtcggctttaataaagttttcggttat
tacattgaagtgacaaaagcaaacttgcatttgcttgaggaagggcgttatgagcggaag
cagacgttaaccaatgcagagcgctacattacacctgaattaaaagaaaaagaagcgctc
attttagaggcggaaaataacatctgtgagctggagtacgagctgtttaccgagctgcgc
gagaaagtgaagcagtatattccgcggctgcagcagcttgcaaaacagatgagcgagctg
gacgcactgcaatgctttgcgacaatcagtgaaaatcgccactacacgaaaccagagttc
tctaaagatgaagtcgaagtgattgaaggcagacacccggttgttgaaaaagtcatggac
agccaggaatatgtcccgaacaactgtatgatgggcgataacagacaaatgcttctcatt
acaggtccaaacatgtcagggaaaagcacgtatatgagacaaatcgcgctcatttccatt
atggcgcaaatcggctgctttgtacccgcgaaaaaagcggtgctcccgattttcgatcaa
atttttacgcgaatcggcgctgcagatgatttgatttccggacaaagtacatttatggta
gaaatgcttgaagcgaaaaatgcgattgtcaatgcgacgaaaaacagcctcattctgttt
gatgaaatcgggcggggaacgtccacttatgacggcatggcgctggcacaggcgattatt
gaatatgttcacgatcatatcggcgccaagacgctgttcagcacacactatcacgagctg
accgttcttgaggacaagctgccccagctgaaaaacgttcatgttcgcgctgaagaatat
aacggaacggttgtctttcttcatcaaattaaagaaggtgcggctgataaaagctatggt
atccatgtagctcagcttgccgaactgccgggagatctgattgcgcgcgctcaagatatt
ttaaaagagcttgagcattcaggaaacaaaccggaagtgccggtgcagaaacctcaggtg
aaagaagagccggcacagctgtccttttttgacgaagcggaaaagccggctgaaacacca
aagctttcaaaaaaagaaaagcaagtgatcgatgctttcaaatcacttaatatactggat
atgacaccgcttgaagcgatgaatgaaatgtacaagctgcaaaagaaattacattaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU28580
Entry
BSU28580          CDS       T00010                                 

Symbol
mutSB
Name
(RefSeq) methyl-directed mismatch repair protein MutS
  KO
K07456  DNA mismatch repair protein MutS2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    BSU28580 (mutSB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU28580 (mutSB)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     BSU28580 (mutSB)
SSDB
Motif
Pfam: MutS_V Smr MSSS MutS_III
Other DBs
NCBI-GeneID: 937447
NCBI-ProteinID: NP_390736
Pasteur: BG12328
BSORF: BG12328
UniProt: P94545 A0A6M3ZEY8
Position
complement(2920936..2923293)
AA seq 785 aa
MQQKVLSALEFHKVKEQVIGHAASSLGKEMLLELKPSASIDEIKKQLDEVDEASDIIRLR
GQAPFGGLVDIRGALRRAEIGSVLSPSEFTEISGLLYAVKQMKHFITQMAEDGVDIPLIH
QHAEQLITLSDLERDINSCIDDHGEVLDHASETLRGIRTQLRTLESRVRDRLESMLRSSS
ASKMLSDTIVTIRNDRFVIPVKQEYRSSYGGIVHDTSSSGATLFIEPQAIVDMNNSLQQA
KVKEKQEIERILRVLTEKTAEYTEELFLDLQVLQTLDFIFAKARYAKAVKATKPIMNDTG
FIRLKKARHPLLPPDQVVANDIELGRDFSTIVITGPNTGGKTVTLKTLGLLTLMAQSGLH
IPADEGSEAAVFEHVFADIGDEQSIEQSLSTFSSHMVNIVGILEQVNENSLVLFDELGAG
TDPQEGAALAMSILDDVHRTNARVLATTHYPELKAYGYNREGVMNASVEFDIETLSPTYK
LLIGVPGRSNAFEISKRLGLPDHIIGQAKSEMTAEHNEVDTMIASLEQSKKRAEEELSET
ESIRKEAEKLHKELQQQIIELNSKKDKMLEEAEQQAAEKVKAAMKEAEDIIHELRTIKEE
HKSFKDHELINAKKRLEGAMPAFEKSKKPEKPKTQKRDFKPGDEVKVLTFGQKGTLLEKT
GGNEWNVQIGILKMKVKEKDLEFIKSAPEPKKEKMITAVKGKDYHVSLELDLRGERYENA
LSRVEKYLDDAVLAGYPRVSIIHGKGTGALRKGVQDLLKNHRSVKSSRFGEAGEGGSGVT
VVELK
NT seq 2358 nt   +upstreamnt  +downstreamnt
gtgcagcaaaaagtattatcagctcttgaatttcataaagtgaaagaacaggttattggg
catgccgcttcatcgctcggaaaagaaatgcttctcgagcttaagccttctgcttctata
gacgaaatcaaaaaacagctggatgaagtagacgaagcttctgacattatccggctgaga
ggccaagcgccatttggcggccttgtagatatcagaggagcgttaagacgggcggaaatc
ggcagcgttctcagtccttctgaattcactgaaatctcaggcctgctttatgcagttaaa
caaatgaaacattttatcacgcaaatggctgaagacggtgtcgacattccgctgatccat
cagcatgctgaacagcttatcacgctgtccgatttagagcgggacattaattcctgcatt
gatgatcacggagaagtgcttgatcatgcatcggaaacattaagaggaatccgcacacag
ctcagaacactcgaatcaagagtcagagaccggttagagtcgatgctgcgttcctcttcc
gcatcgaaaatgctgtctgatacgattgttacgattcggaatgaccgctttgtgatcccg
gtcaaacaggagtacagatccagctatggaggaattgtgcacgacacctcatcctctggt
gcgacactattcattgaaccgcaggcgattgtagatatgaacaattcccttcagcaggcg
aaagtgaaagaaaagcaagaaattgaacggattttgcgtgtgctgacagagaaaacggca
gagtatacagaggagctatttctagatttgcaagtgctgcagacgcttgactttattttt
gcaaaagctagatatgcaaaagcggttaaagcgacaaaaccgattatgaacgacaccggc
tttatccgtttgaaaaaagcccgccatccattgcttccgcctgatcaggttgttgccaat
gacatcgagcttggccgcgatttttcaaccattgtcatcacagggccaaacaccgggggg
aaaacagtcacccttaaaacgttaggcctgctaaccttaatggcgcagtcaggtcttcat
atcccggcagatgaagggtcagaagcggcagtatttgagcacgtattcgctgatatcggt
gatgaacagtcgattgagcaaagtttaagtacgttctcatcccatatggtgaatattgtc
ggcattttagaacaggtcaatgaaaacagccttgtgcttttcgatgaacttggtgcaggg
acagatccgcaggagggggcggccctcgccatgagcatcttggatgacgtgcatcgcacc
aatgcacgagtgttagctacgacgcattatccggaattgaaggcgtacggctataacaga
gaaggcgtcatgaatgccagcgttgaatttgacatcgaaacgctgtcaccgacctataaa
cttttaattggtgtgccgggtcgaagcaatgctttcgaaatttcaaaacgcctcgggctc
ccggaccatatcatcgggcaggcgaagtcagaaatgacggccgagcataacgaagtcgat
acgatgattgcgtcgctggaacaaagcaaaaaacgtgcggaagaagagctttctgagaca
gaatcaatcagaaaagaagcggaaaaactgcataaagagctgcagcagcaaatcatcgag
cttaacagcaaaaaagacaaaatgcttgaagaggcagaacagcaggctgctgaaaaagta
aaagcggcaatgaaagaagccgaggacattattcatgaattgcgcaccataaaagaagaa
cacaaatccttcaaggatcacgagctgattaacgcgaagaaacggttagaaggcgctatg
cctgcttttgaaaagtccaagaaaccggaaaagccgaaaacgcaaaaacgcgactttaag
cctggcgacgaggtgaaagtcctcactttcgggcaaaaaggaacattgctcgaaaaaaca
ggcggcaatgaatggaacgttcaaatcggtattttaaagatgaaagtaaaagaaaaagat
ctggagtttatcaaatcagctccggagccaaaaaaagaaaaaatgattacagcggtcaaa
ggaaaggactatcacgtatcgcttgaacttgatcttcgcggcgaacgctatgaaaatgcc
ctcagccgggttgaaaaatacttggatgatgcggtgttagccggatatccaagagtgtca
atcatccacggaaaaggaaccggcgctttaagaaaaggcgtacaggatcttctgaaaaac
caccgcagcgtcaaaagttcccgtttcggtgaagcaggtgagggaggatcaggcgttacg
gttgttgaactaaaataa

DBGET integrated database retrieval system