KEGG   Bacillus subtilis subsp. subtilis 168: BSU17380
Entry
BSU17380          CDS       T00010                                 

Gene name
nrdE
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit alpha
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP => dCTP
bsu_M00938  Pyrimidine deoxyribonuleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU17380 (nrdE)
   00240 Pyrimidine metabolism
    BSU17380 (nrdE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU17380 (nrdE)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     BSU17380 (nrdE)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BSU17380 (nrdE)
SSDB
Motif
Pfam: Ribonuc_red_lgC RNR_N Ribonuc_red_lgN Fib_succ_major
Other DBs
NCBI-GeneID: 940091
NCBI-ProteinID: NP_389620
Pasteur: BG11404
BSORF: BG11404
UniProt: P50620 A0A6M4JGM8
Structure
PDB: 

Position
1868969..1871071
AA seq 700 aa
MSQNQVPKWIQLNNEIMIQKDGKFQFDKDKEAVHSYFVDYINQNTVFFHNLKEKLDYLVE
NQYYEEEFLSLYSFEDIKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYED
RISIVALFFANGDTEKAKEYVNLMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLN
DISRAIDISMQLSKLGGGVSLNLSKLRAKGEAIKDVENATKGVVGVMKLLDNAFRYADQM
GQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSIGVVIPDKFVELAREDKAAYV
FYPHTIYKEYGQHMDEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLRSESGYPYIMF
QDNVNKVHANNHISKVKFSNLCSEVLQASQVSSYTDYDEEDEIGLDISCNLGSLNILNVM
EHKSIEKTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYE
SPEARDFANTFFMMVNFYSIQRSAEIAKEKGETFDQYEGSTYATGEYFDKYVSTDFSPKY
EKIANLFEGMHIPTTEDWKKLKAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMER
IEERTYGNSKTYYPMPGLASNNWFFYKEAYDMDMFKVVDMIATIQQHIDQGISFTLFLKD
TMTTRDLNRIDLYAHHRGIKTIYYARTKDTGQDSCLSCVV
NT seq 2103 nt   +upstreamnt  +downstreamnt
ttgtcacaaaatcaagtgccaaaatggatccagttaaataacgaaatcatgatccaaaaa
gatgggaaattccagtttgataaggataaagaagctgtacatagctattttgtagattat
atcaatcaaaacacagtcttctttcacaatttaaaagagaagctggattatttggttgaa
aaccaatactacgaagaggaattcttaagcctttattcttttgaagacattaaagaagtg
tttaagacagcttacgctaagaagtttcgttttccttccttcatgagtgcgtttaaattc
tataatgactatgctttgaaaacgaatgacaagaaaaaaatcctcgagcgttatgaggac
cggatctcaattgttgcgctgttcttcgctaacggcgacactgagaaagcaaaagaatat
gtaaacctgatgatcaatcaagaatatcagccgagcacaccgacatttttgaatgccggc
agaaaacgccgcggtgaacttgtgagctgcttcttgctcgaagttaatgattctttaaat
gacatttcaagagcaatcgatatctccatgcagctttctaagcttggtggcggggtttct
cttaacctgtccaagcttcgcgcgaaaggtgaagccattaaagatgttgagaatgcgaca
aaaggcgttgtaggcgtcatgaagcttcttgataacgcgttccgttacgctgaccaaatg
ggacaaagacaaggctccggcgcggcgtatttaaacattttccaccgcgatatcaatgat
tttcttgatacgaaaaagatttctgcggatgaagatgtgcgtgtcaaaacgctttcgatc
ggtgttgtcattccggataagttcgttgagcttgcacgcgaggacaaagcggcttatgta
ttctacccgcacacgatttataaagagtacggccagcacatggatgagatggacatgaac
gaaatgtacgacaagtttgtcgacaaccctcgggtgaaaaaggaaaaaatcaacccgcgg
aaactgcttgaaaaattggcgatgcttcgttctgaatcaggctatccatacatcatgttc
caagataacgtcaataaagtgcatgcgaataaccatatttccaaggtcaaattttctaac
ctttgctctgaagtgctgcaggcatctcaagtttcttcatacacagactatgatgaagaa
gatgaaatcggtctggatatttcctgcaacctgggttcgcttaacattctcaatgtcatg
gagcataaatcaatcgaaaagacagtcaagcttgcgacagactctttaacacacgtgtct
gaaacaacagacatccgtaatgcgcctgctgtaagacgggcaaacaaagcgatgaaatca
atcggcctcggtgctatgaaccttcacggctaccttgcgcaaaacggcattgcgtatgaa
agtccggaagcgcgtgactttgcaaacacgttctttatgatggtgaatttctactccatc
cagcgttctgcggaaatcgcaaaagagaagggcgaaacgtttgatcaatatgaaggatca
acctatgcgacaggtgaatacttcgacaaatacgtttcaactgatttctcaccgaaatac
gaaaaaatcgctaatctgtttgaaggtatgcatatcccgacgacagaggactggaaaaag
ctaaaagcatttgtcgctgaacacggtatgtatcacagctacagattatgcattgcgccg
acaggctctatctcatacgttcaatcaagcacggcgtctgttatgccgattatggaacgg
attgaagaacgaacatacggcaactcaaaaacgtactacccaatgcctgggcttgcatct
aataactggttcttctataaagaagcctacgatatggacatgttcaaggttgtggatatg
atcgccactatccagcagcacattgatcagggaatcagctttacattgttcttaaaagac
acaatgacgacccgagatttaaaccgaatcgatctgtatgcacatcatagaggaattaaa
accatttactatgcaagaacgaaagatactgggcaagacagctgcctttcttgtgttgtt
tga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU17390
Entry
BSU17390          CDS       T00010                                 

Gene name
nrdF
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit beta
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP => dCTP
bsu_M00938  Pyrimidine deoxyribonuleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU17390 (nrdF)
   00240 Pyrimidine metabolism
    BSU17390 (nrdF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU17390 (nrdF)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     BSU17390 (nrdF)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BSU17390 (nrdF)
SSDB
Motif
Pfam: Ribonuc_red_sm DUF2247
Other DBs
NCBI-GeneID: 940076
NCBI-ProteinID: NP_389621
Pasteur: BG11405
BSORF: BG11405
UniProt: P50621 A0A6M4JIK1
Structure
PDB: 
4DR0

Position
1871089..1872078
AA seq 329 aa
MTKIYDAANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKVLA
GLTLLDTEQGNTGMPIVAEHVDGHQRKAVLNFMAMMENAVHAKSYSNIFMTLAPTETINE
VFEWVKQNKYLQKKAQMIVGLYKAIQKDDEISLFKAMVASVYLESFLFYSGFYYPLYFYG
QGKLMQSGEIINLILRDEAIHGVYVGLLAQEIYNKQTEEKKAELREFAIDLLNQLYENEL
EYTEDLYDQVGLSHDVKKFIRYNANKALMNLGFDPYFEEEDINPIVLNGLNTKTKSHDFF
SMKGNGYKKATVEPLKDDDFYFEDEKEQI
NT seq 990 nt   +upstreamnt  +downstreamnt
gtgacaaaaatttatgacgcagcaaactggtcaaagcatgaagacgattttacccaaatg
ttctataaccaaaacgtgaaacagttctggcttccggaagagattgctttaaacggcgat
ctcctcacatggaagtacctcggaaaaaatgagcaggacacttatatgaaggtactggcc
ggacttacgcttcttgacacagagcaggggaatacggggatgccgatcgtggctgaacac
gtagatggccaccagcggaaagcggtgctgaactttatggcgatgatggagaacgctgtc
catgcgaagtcgtactctaatattttcatgacccttgcaccgactgaaacgatcaatgaa
gtatttgaatgggttaaacaaaataaatatttgcagaaaaaagcgcaaatgattgtcggg
ctttacaaagccattcaaaaagatgatgaaatttcactgttcaaagccatggttgcttcc
gtctatctggaaagcttccttttctacagcggtttctattatccgttatatttctacgga
caaggaaaactgatgcaaagcggtgagatcattaacctgatccttcgtgacgaagcgatt
cacggcgtgtatgtcggtctccttgctcaggaaatttataataaacagacagaagagaaa
aaagcagagcttcgtgaatttgcgatcgacctcctgaatcagttatatgaaaatgagctt
gagtatacagaggacttgtacgatcaagtcgggctctcacatgatgtaaagaaattcatc
cgctataatgcgaataaagcgctgatgaaccttggatttgatccatacttcgaagaggaa
gacattaatccgatcgttttaaacggattaaacacaaaaacaaaatcgcatgacttcttc
tctatgaaggggaatggctataaaaaagcgacagttgagccgctcaaagatgatgacttt
tattttgaagatgaaaaagagcagatataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU20040
Entry
BSU20040          CDS       T00010                                 

Gene name
nrdF
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit beta
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP => dCTP
bsu_M00938  Pyrimidine deoxyribonuleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU20040 (nrdF)
   00240 Pyrimidine metabolism
    BSU20040 (nrdF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU20040 (nrdF)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     BSU20040 (nrdF)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BSU20040 (nrdF)
SSDB
Motif
Pfam: Ribonuc_red_sm DUF533
Other DBs
NCBI-GeneID: 939476
NCBI-ProteinID: NP_389886
Pasteur: BG13725
BSORF: BG13725
UniProt: O30601
Position
complement(join(2159981..2160388,2161197..2161778))
AA seq 329 aa
MTKIYDAANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKVLA
GLTLLDTEQGNTGMPIVAEHVDGHQRKAVLNFMAMMENAVHAKSYSNIFLTLAPTEQINE
VFEWVKNNRFLQKKARTIVSVYKTIKKNDEISLFKGMVASVFLESFLFYSGFYYPLYFYG
QGKLMQSGEIINLIIRDEAIHGVYVGLLAQEIYKKQTPQKQKELYAWALNLLQELYENEL
EYTEDVYDQVGLAPDVKKFIRYNANKALNNLGFDHWFEEEDVNPIVINGLNTKTKSHDFF
STKGNGYKKATVEPLKDSDFIFTEKGCIQ
NT seq 990 nt   +upstreamnt  +downstreamnt
ttgacaaaaatttatgacgcagcaaactggtcaaagcatgaagacgattttacccaaatg
ttctataaccaaaacgtgaaacagttctggcttccggaagagattgctttaaacggcgat
ctcctcacatggaagtacctcggaaaaaatgagcaggacacttatatgaaggtactggcc
ggacttacgcttcttgatacagagcaggggaatacggggatgccgatcgtggctgaacac
gtagatggacatcaaagaaaggcagttttaaatttcatggccatgatggaaaatgctgtt
catgcaaagtcttacagcaacatctttctaacattggctccaaccgagcagatcaatgaa
gtctttgaatgggtgaaaaacaataggtttcttcaaaagaaagctagaacaattgtttca
gtctataaaacaatcaagaaaaacgatgaaatttctttatttaaaggaatggttgcatct
gtgttcctggagagttttcttttctactcagggttttattacccactttatttttatgga
caaggaaagttaatgcaaagtggagagatcattaacctgattattagagacgaagcgata
catggcgtatatgtaggattgttagctcaagagatttataagaagcaaacgccacagaag
caaaaagaactgtacgcatgggctttaaacttactgcaggaactttacgaaaatgaattg
gagtatacagaagatgtctatgatcaggttggattagctccagatgtaaagaaattcatc
agatacaacgcaaataaagctttaaacaatctgggctttgatcattggtttgaagaagag
gatgttaatccaattgttatcaatggtttgaacactaagactaaatcccatgacttcttt
tcaactaaagggaatggatacaaaaaagcaacagtggagcctttaaaggattcagatttc
atttttaccgagaaaggatgtattcaatga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU20060
Entry
BSU20060          CDS       T00010                                 

Gene name
nrdEB
Definition
(RefSeq) ribonucleoside-diphosphate reductase NrdEB subunit alpha
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP => dCTP
bsu_M00938  Pyrimidine deoxyribonuleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU20060 (nrdEB)
   00240 Pyrimidine metabolism
    BSU20060 (nrdEB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU20060 (nrdEB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     BSU20060 (nrdEB)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BSU20060 (nrdEB)
SSDB
Motif
Pfam: Ribonuc_red_lgC RNR_N LAGLIDADG_3 Ribonuc_red_lgN Intein_splicing LAGLIDADG_WhiA
Other DBs
NCBI-GeneID: 939475
NCBI-ProteinID: NP_389888
Pasteur: BG13723
BSORF: BG13723
UniProt: O31875
Position
complement(join(2162108..2164642,2164895..2165614))
AA seq 1084 aa
MTNTIPNWIKLNNEIMIQKDGKYQFEKDKEAVHSYFVDYINQNTVFFHDLKEKLDYLIKN
DYYEEEFLSKYTFEQIKSIYKIAYSYKFRFPSFMSAFKFYNDYALKTNDKTKILERYEDR
VSIVALYCADGDYEKAVEEVHTMMKQEYQPATPTFLNAGRKRRGEMVSCFLLEVGDSLND
ISRAIDISMQLSKLGGGVALNLNKLRAKGEAIKDVENATKGVVGVMKLLDNAFRYADQMG
QRQGSGAVYLSVFHPDITDFLDTKKISADEDVRVKTLSIGVVVPDKFIELAREDKDYYMF
YPHSVYKEYGQYLDELDINEMYDELVENPRVRKAKGNARKLLEQLAILRSESGYPYIMFA
DNVNKVHPNEHISKVKFSNLCVTGETLLLTENGYEKAADLYKKQNDLKVVIDNRTKDFAV
GSKGTTIVDAIPMQLTKKDAEIFKVKTKQGYEIRATEWHKFYVKRDGEIQKLQLNQLKTG
DKLLVQSAEGAYGKIHEPDLAYIMGIIAGDGTITEKTAKIYLYDNKKVLEQKVTDAVHRI
IQKHKVDRAYKHNTSLLPTFNMANPEKQDLLYMNSTVLFDILKKFGMNKETKTRVPEFIF
QANKETQAAYLSGLFQTDGCVNANHKAKALTIELTSIHYESLQDVQKLLLNMGVYTTIYS
NNKRSQELLPDGKGGSKLYNVKPTHKISIQDRNSRELFMSIVEMKEYDVYKFNLLTETLQ
PKSRKPKHDFTAEIISIEEDGVEDVYDTTQEDYHSLIFNGIVTGNCSEVLQSSQVSVYTD
YDKEDEIGLDISCNLGSMNIVNVMSNQSIASTVRIAIDSLTTVTRKTNIVNAPAVARANT
LMRSIGLGQMNLHGFLAQNNIAYESEEAKDFANTYFMMVNFYSLQRSMEIARETGETYYK
FDGSTYKSGEYFEKYVTNDYSPQYEKVKKLFGDQHIPNIQDWMKLKEDVMKYGLYHSYRQ
AIAPTGSISYVQSSTAGVMPIMERIEERTYGNSKTYYPMPGLSAQNWFFYKEAYDMDMFK
VVDLIATIQQHVDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTLYYARTKDTTQEGCL
SCVV
NT seq 3255 nt   +upstreamnt  +downstreamnt
ttgacaaacacaataccaaattggatcaagctcaataatgaaatcatgatccagaaagat
gggaagtatcaatttgaaaaggataaggaggccgtacatagttactttgttgattacata
aatcaaaacacagtctttttccatgatctgaaagagaagctggactatctgattaaaaat
gattattacgaggaagaattcttaagcaaatatacattcgaacagattaaatcaatctat
aagattgcttacagttacaaattcagattcccttcttttatgagtgcctttaagttctac
aatgactacgcattgaagacaaacgataaaacaaagatcctggaaaggtatgaggatcgt
gtctcaattgtggctttatattgcgctgatggcgattacgagaaggctgttgaggaagta
catactatgatgaaacaagagtatcagccagcaacacctactttccttaatgctggacgt
aagcgaagaggtgaaatggtgagctgcttcttacttgaagtaggcgacagtttgaatgat
atttcacgtgctattgatatttccatgcagctttctaagctaggtggaggagtagcatta
aatctaaacaaactaagagccaaaggtgaagcgattaaagacgtagagaatgcgactaaa
ggtgtcgtaggtgttatgaaacttctagataatgccttcagatatgccgaccaaatgggt
caaagacaaggatcaggagcagtttatctaagtgtattccatccagacattacagacttc
ctggataccaaaaaaataagtgctgatgaagatgtccgagttaaaacactgtctattggc
gtagttgttccagacaaatttattgaattggcaagggaagacaaggattattacatgttc
tatccgcattcagtatacaaggagtatgggcagtatctagatgagctagacattaatgaa
atgtatgatgagcttgttgaaaatccaagagttagaaaagcaaagggaaatgctcgaaag
ttgttggagcaattggctattctaagaagcgaatctggctatccgtatattatgttcgct
gacaatgtaaataaagtgcatccaaatgaacatatttcaaaagtgaagttttcaaatttg
tgcgttactggagaaacacttcttttaactgagaatggatatgaaaaagcagccgatctt
tataaaaagcagaatgatcttaaagtggtcattgataatagaacaaaagattttgcagtt
ggtagcaaaggtaccacaattgtagatgcaattccaatgcaactgactaaaaaagatgcg
gaaatatttaaagtcaaaacgaagcaaggatatgaaattagggcaactgagtggcacaaa
ttctatgtgaaaagagatggtgaaattcaaaagctccaattgaatcaactgaaaacaggc
gataaattattagtccaatcagctgaaggagcatacgggaaaattcatgaacccgatctt
gcatacattatgggcattatagctggtgatggaaccattactgaaaaaactgccaagatt
tatttatacgataataaaaaagttcttgagcagaaagttactgatgcagttcaccgtatt
attcaaaaacacaaggttgatcgtgcttataagcacaatacatcacttctcccaacattt
aatatggccaacccagaaaaacaagatttgctctacatgaatagtactgtcttatttgac
atcttgaagaagttcggtatgaacaaagaaacaaaaacaagagtcccagaattcattttt
caagctaataaggaaacgcaagcagcttatttatcgggtttattccagactgatgggtgt
gtaaatgcaaatcataaagccaaagcattaactattgagttaacatccatccactatgag
agccttcaggacgttcagaagctgttactgaacatgggtgtttatacaacgatttattct
aacaacaagcgctcacaagaactccttcctgatggaaaaggtggttctaagctttacaat
gtaaaaccaacacacaaaatcagtattcaagatagaaactcaagagagttgtttatgagt
attgttgaaatgaaagaatacgatgtttataaattcaatttgttaactgagacattgcaa
cctaagtcaagaaagccaaagcatgattttacagctgaaattattagtattgaagaagat
ggtgttgaggatgtttatgatacaacacaagaagactatcactctctgattttcaatgga
attgttactggtaactgttcagaggtacttcaatcgtcacaagtatcagtttatacggat
tacgataaagaggatgaaattggcttagatatctcatgtaatcttggctcaatgaacatt
gtaaatgtaatgagtaatcaatcaattgcttcaacagtcagaatagcaattgactcactg
acaactgtcacaaggaaaacaaacattgtaaatgctccagcagttgcgagagcaaataca
ttaatgagatcaattggtctagggcagatgaacctccatggatttctagctcaaaataat
attgcttatgaaagtgaagaagctaaggattttgcaaatacatactttatgatggttaac
ttctactcactgcagcgttctatggaaattgcacgagaaacaggggagacatactacaag
tttgatggttcgacttataaatcaggcgagtatttcgaaaagtacgtaacaaatgattat
agccctcagtatgaaaaggttaaaaagctatttggagatcaacatattcctaatattcaa
gattggatgaagcttaaagaagatgtaatgaaatatggtctttatcattcctatagacaa
gctattgcgcctacgggaagcatctcatatgttcaatcatctacagcaggtgtaatgcca
attatggagagaattgaggaacgtacatacggaaacagtaagacatattatccgatgcca
ggtttatcggctcagaattggttcttctataaggaagcatacgacatggatatgtttaag
gtagttgatcttattgcaacaattcagcagcacgtcgaccaagggatttcatttacgttg
ttcttaaaggatacgatgacgacgagagacctaaatagaatagacctctacgcacatcat
cgtggaattaaaactttatattatgccagaactaaagatacgacccaagagggatgcttg
tcctgtgtagtttaa

DBGET integrated database retrieval system