KEGG   Bacillus subtilis subsp. subtilis 168: BSU18180
Entry
BSU18180          CDS       T00010                                 

Symbol
yngB
Name
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase YngB
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00052  Galactose metabolism
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu00541  O-Antigen nucleotide sugar biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
bsu01250  Biosynthesis of nucleotide sugars
Module
bsu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
bsu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU18180 (yngB)
   00052 Galactose metabolism
    BSU18180 (yngB)
   00500 Starch and sucrose metabolism
    BSU18180 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU18180 (yngB)
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BSU18180 (yngB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BSU18180 (yngB)
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2
Other DBs
NCBI-GeneID: 936791
NCBI-ProteinID: NP_389700
Pasteur: BG13453
BSORF: BG13453
UniProt: O31822 A0A6M4JJN0
Position
1946702..1947595
AA seq 297 aa
MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAESGIEDILIITGR
NKRSIEDHFDRSAELEFNLREKGKTETLKEMQQIADLANIHYIRQKEPLGLGHAVLCAEH
FIGDEPFAVLLGDDIMVSETPALRQLMDVYDVYGTEVVGVQSVLPEDVSKYGIINTSGSQ
GHVYEVNDLVEKPSPEEAPSEIAVMGRYVLNSSIFSVLKTIGRGAGNEIQLTDALREVCR
KEPIHARLLEGNRYDIGDKLGCFKASTEIGLMRPEMRSQLLAYLEDVIKRETKEMLR
NT seq 894 nt   +upstreamnt  +downstreamnt
atgagaaaaaaagtgagaaaagcggttatacccgcagcgggtttaggaacgagatttctg
ccggcgacaaaggcgcagcctaaagaaatgcttccaatcgtcgacaaaccagcaatccaa
tatattgtagaagaggccgcagagtcaggaattgaagatatactgattattacagggaga
aacaaacgctcgattgaagatcattttgatcggtcggcggaattggaattcaatctccgg
gaaaaaggcaagacggagacacttaaggaaatgcagcagattgccgatttggccaacatt
cattacatccgccagaaagaaccgctcggattaggccatgcggtgctgtgtgcggagcat
tttatcggagatgagccttttgctgttctcttaggtgatgatattatggtgtctgaaaca
ccggctcttcggcaattaatggatgtatatgacgtttatggcacagaggttgtcggtgta
cagtcagttctccctgaggatgtcagcaaatatggtattataaatacatcagggtctcaa
gggcatgtatatgaagtgaacgatttagtggaaaagccttctcctgaagaagcaccttcg
gaaatcgcagtaatgggacgttatgtgctgaattcttcgatcttctccgttttgaagaca
attggcagaggcgcgggcaacgaaattcagctgacagatgcgcttcgtgaggtttgccgt
aaggagccgatccatgcccggctgctggaaggaaatcgatatgacattggcgataagctg
ggctgttttaaagcgagcaccgaaatcggcttaatgcgtcccgaaatgagatctcagctt
ttggcctatttagaagatgtgatcaaacgggaaacgaaagaaatgctgcggtaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU30850
Entry
BSU30850          CDS       T00010                                 

Symbol
ytdA
Name
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00052  Galactose metabolism
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu00541  O-Antigen nucleotide sugar biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
bsu01250  Biosynthesis of nucleotide sugars
Module
bsu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
bsu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU30850 (ytdA)
   00052 Galactose metabolism
    BSU30850 (ytdA)
   00500 Starch and sucrose metabolism
    BSU30850 (ytdA)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU30850 (ytdA)
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BSU30850 (ytdA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BSU30850 (ytdA)
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Other DBs
NCBI-GeneID: 937119
NCBI-ProteinID: NP_390963
Pasteur: BG11199
BSORF: BG11199
UniProt: P42407 A0A6M3ZFW4
Position
complement(3154735..3155553)
AA seq 272 aa
MIKKAIIPAGGFGTRNLPVTKVIPKEMFPVGSKPVIHYLVEELKESGIEDILMVVSSHKN
LIVDYFDSSLALEAFLASKNKLHLLREHPIPDIRIHYVRQPYAKGLGDAISFGKQFAGGE
PFAVVLPDDLIFSANQPALGQLIEAYTKYQSSVIGLKETKTEDLHHYGVIKGEPVEKGLY
RIQDIVEKPKQNPPSHFAAAGRYIFTPDIFNELEALEADSGGEVQVTDAIKASLGACTVY
GKLLEGERYDIGLQKDYLKLIYDMLKTEKNPQ
NT seq 819 nt   +upstreamnt  +downstreamnt
atgataaaaaaagcgatcattcctgcaggcggattcggcacgagaaatctgccggtgacg
aaggtgattccgaaagaaatgtttccggtaggatctaagcctgtgattcattatcttgtt
gaagaattaaaggagtcaggcattgaggacattttgatggttgtatcgagccataaaaat
ctgattgtcgactattttgattcctctttggcacttgaggcttttttggcctctaagaat
aaactgcatttacttagagagcatcccattccggatatacggattcactatgtgcggcag
ccttatgcaaagggtcttggcgacgccatttctttcggaaagcaatttgcaggaggagag
ccttttgccgtcgttttgccagatgatctgattttttccgccaatcagccggctttgggg
cagctgattgaagcgtatacgaaatatcagtccagtgtgatcggcttaaaagaaacaaaa
acggaggatttacatcattacggggtgataaaaggggagcctgttgaaaaagggctttat
cgcatacaggatattgtggaaaagcctaaacaaaaccctccgtctcattttgccgcagca
gggcgttatattttcacaccggatatttttaatgagctggaggcattagaagctgatagc
ggaggagaagtgcaggtaacggatgcgataaaagcttcgctcggggcatgtaccgtatac
gggaaattgctagagggcgagcggtatgacatcggcctgcaaaaggattatctgaagctg
atttacgatatgctgaaaacggaaaagaacccccaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU35670
Entry
BSU35670          CDS       T00010                                 

Symbol
gtaB
Name
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00052  Galactose metabolism
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu00541  O-Antigen nucleotide sugar biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
bsu01250  Biosynthesis of nucleotide sugars
Module
bsu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
bsu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU35670 (gtaB)
   00052 Galactose metabolism
    BSU35670 (gtaB)
   00500 Starch and sucrose metabolism
    BSU35670 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU35670 (gtaB)
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BSU35670 (gtaB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BSU35670 (gtaB)
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Other DBs
NCBI-GeneID: 936797
NCBI-ProteinID: NP_391447
Pasteur: BG10402
BSORF: BG10402
UniProt: Q05852 A0A6M3ZL57
Position
3665629..3666507
AA seq 292 aa
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKS
KRAIEDHFDYSPELERNLEEKGKTELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAETPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSEG
RRYQVKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTDAIQKLNEI
QRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFMEGLLNKEEI
NT seq 879 nt   +upstreamnt  +downstreamnt
atgaaaaaagtacgtaaagccataattccagcagcaggcttaggaacacgttttcttccg
gctacgaaagcaatgccgaaagaaatgcttcctatcgttgataaacctaccattcaatac
ataattgaagaagctgttgaagccggtattgaagatattattatcgtaacaggaaaaagc
aagcgtgcgattgaggatcattttgattactctcctgagcttgaaagaaacctagaagaa
aaaggaaaaactgagctgcttgaaaaagtgaaaaaggcttctaacctggctgacattcac
tatatccgccaaaaagaacctaaaggtctcggacatgctgtctggtgcgcacgcaacttt
atcggcgatgagccgtttgcggtactgcttggtgacgatattgttcaggctgaaactcca
gggttgcgccaattaatggatgaatatgaaaaaacactttcttctattatcggtgttcag
caggtgcccgaagaagaaacacaccgctacggcattattgacccgctgacaagtgaaggc
cgccgttatcaggtgaaaaacttcgttgaaaaaccgcctaaaggcacagcaccttctaat
cttgccatcttaggccgttacgtattcacgcctgagatcttcatgtatttagaagagcag
caggttggcgccggcggagaaattcagctcacagacgccattcaaaagctgaatgaaatt
caaagagtgtttgcttacgattttgaaggcaagcgttatgatgttggtgaaaagctcggc
tttatcacaacaactcttgaatttgcgatgcaggataaagagcttcgcgatcagctcgtt
ccatttatggaaggtttactaaacaaagaagaaatctaa

DBGET integrated database retrieval system