KEGG   Bacillus subtilis subsp. subtilis 168: BSU19310
Entry
BSU19310          CDS       T00010                                 

Gene name
dhaS
Definition
(RefSeq) aldehyde dehydrogenase DhaS
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00053  Ascorbate and aldarate metabolism
bsu00071  Fatty acid degradation
bsu00280  Valine, leucine and isoleucine degradation
bsu00310  Lysine degradation
bsu00330  Arginine and proline metabolism
bsu00340  Histidine metabolism
bsu00380  Tryptophan metabolism
bsu00410  beta-Alanine metabolism
bsu00561  Glycerolipid metabolism
bsu00620  Pyruvate metabolism
bsu00625  Chloroalkane and chloroalkene degradation
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU19310 (dhaS)
   00053 Ascorbate and aldarate metabolism
    BSU19310 (dhaS)
   00620 Pyruvate metabolism
    BSU19310 (dhaS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSU19310 (dhaS)
   00561 Glycerolipid metabolism
    BSU19310 (dhaS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU19310 (dhaS)
   00310 Lysine degradation
    BSU19310 (dhaS)
   00330 Arginine and proline metabolism
    BSU19310 (dhaS)
   00340 Histidine metabolism
    BSU19310 (dhaS)
   00380 Tryptophan metabolism
    BSU19310 (dhaS)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSU19310 (dhaS)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU19310 (dhaS)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BSU19310 (dhaS)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSU19310 (dhaS)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BSU19310 (dhaS)
SSDB
Motif
Pfam: Aldedh LuxC PYNP_C YCII MMS19_N AceK
Other DBs
NCBI-GeneID: 939963
NCBI-ProteinID: NP_389813
Pasteur: BG12582
BSORF: BG12582
UniProt: O34660 A0A6M4JJ07
Position
2100580..2102067
AA seq 495 aa
MSSLTMQVTKRLETFLQGTKKLYIDGKFVPSASGATFDTPNPATGETLMTLYEAQAADVD
KAVKAARKAFDQGEWRTMSPASRSRLMYKLADLMEEHKTELAQLETLDNGKPINETTNGD
IPLAIEHMRYYAGWCTKITGQTIPVSGAYFNYTRHEPVGVVGQIIPWNFPLLMAMWKMGA
ALATGCTIVLKPAEQTPLSALYLAELIDQAGFPAGVINIIPGFGEDAGEALTNHEAVDKI
AFTGSTEIGKKIMSTAAKSIKRVTLELGGKSPNILLPDANLKKAIPGALNGVMFNQGQVC
CAGSRVFIHKDQYDEVVDEMASYAESLRQGAGLHKDTQIGPLVSKEQHERVLSYIQKGKD
EGAKAVTGGSCPFEAGYFVAPTVFANVEDEMTIAKEEIFGPVLTAIPYETVDEVIERANH
SEYGLAAGLWTENVKQAHYIADRLQAGTVWVNCYNVFDAASPFGGYKQSGLGREMGSYAL
DNYTEVKSVWVNLED
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgagttctttaacgatgcaagtgacgaaaaggctggagacatttttacagggaacaaag
aagctttatattgacggaaagtttgttccgagtgcctcaggggcaacctttgacactcca
aacccggcgaccggcgaaaccttgatgacgctgtatgaagcccaggctgcggatgtggac
aaagctgttaaagctgcccggaaagcctttgaccaaggtgaatggagaacaatgtctcca
gcttcgagaagcagactgatgtataagctggcagacttaatggaagagcataaaactgag
cttgctcagcttgaaacacttgataatgggaaaccgatcaatgaaacgactaatggagat
attccgctggctattgagcatatgcgctattacgccggctggtgtacaaaaataacagga
cagacgattccggtttccggcgcttattttaattatacgcgtcatgagcctgtcggtgtc
gtcggccagatcattccatggaatttcccgctcctgatggcgatgtggaaaatgggcgcg
gcacttgcaacaggctgtacaatcgtcctcaaaccggctgaacaaacaccgctttcagct
ctttatttggcagaattaattgaccaagccggtttccctgccggtgtaatcaacatcatc
ccaggattcggtgaagatgcgggagaagcgctgacgaaccacgaagcggttgataaaatt
gcctttaccggttccactgaaatcggaaagaaaatcatgtccaccgcagcgaaaagcatt
aagcgtgtgacattggagctgggcggaaaatcgcctaatattcttctgccggatgcgaat
ttaaaaaaagccatcccgggcgctttaaacggtgtgatgtttaaccagggccaagtctgc
tgtgcgggctcacgtgtcttcattcataaagaccaatatgatgaagttgttgatgaaatg
gcatcctatgctgagtcactccgccaaggagcgggacttcataaagatactcaaatcggg
cctctcgtaagcaaggaacagcatgagcgcgttctttcctatattcaaaaaggaaaagat
gaaggagcaaaagcagtgaccggcggaagctgtccttttgaagcaggatattttgtcgca
ccgactgtgtttgcgaatgttgaagacgaaatgaccatcgcaaaagaagaaattttcgga
cccgtgctgactgcaattccgtacgaaacagtcgatgaagttattgaacgggcaaaccat
tcagaatatgggcttgcagccggactatggacagagaacgtcaagcaggctcactatatc
gcggaccgacttcaagccggaaccgtttgggtcaactgctataatgtgtttgacgcggcg
tctccatttggcggttataaacagtcaggactcggacgagaaatgggatcatatgccttg
gataattacacagaagtcaaaagtgtatgggtaaaccttgaagactaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU37960
Entry
BSU37960          CDS       T00010                                 

Gene name
ywdH
Definition
(RefSeq) aldehyde dehydrogenase YwdH
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00053  Ascorbate and aldarate metabolism
bsu00071  Fatty acid degradation
bsu00280  Valine, leucine and isoleucine degradation
bsu00310  Lysine degradation
bsu00330  Arginine and proline metabolism
bsu00340  Histidine metabolism
bsu00380  Tryptophan metabolism
bsu00410  beta-Alanine metabolism
bsu00561  Glycerolipid metabolism
bsu00620  Pyruvate metabolism
bsu00625  Chloroalkane and chloroalkene degradation
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU37960 (ywdH)
   00053 Ascorbate and aldarate metabolism
    BSU37960 (ywdH)
   00620 Pyruvate metabolism
    BSU37960 (ywdH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSU37960 (ywdH)
   00561 Glycerolipid metabolism
    BSU37960 (ywdH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU37960 (ywdH)
   00310 Lysine degradation
    BSU37960 (ywdH)
   00330 Arginine and proline metabolism
    BSU37960 (ywdH)
   00340 Histidine metabolism
    BSU37960 (ywdH)
   00380 Tryptophan metabolism
    BSU37960 (ywdH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSU37960 (ywdH)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU37960 (ywdH)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BSU37960 (ywdH)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSU37960 (ywdH)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BSU37960 (ywdH)
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-GeneID: 937252
NCBI-ProteinID: NP_391675
Pasteur: BG10604
BSORF: BG10604
UniProt: P39616 A0A6M4JQE7
Position
3896290..3897660
AA seq 456 aa
MNSIPSIISKHKAYFAAGHTRPLESRLNILRKLKQAVRTHEADLIAALYQDLHKSEQEAY
STEIGIVLEEISFVMKRLRKWSKPKRVKTPLTHLGSKSIIIPEPYGTVLVIAPWNYPLQL
ALSPLIGAIAAGNTVVLKPSEYTPAVSAILSKLISSVFPTDYVAMAEGGPDVSTALLQQP
FDYIFFTGSVAVGKIVMEAAAKQLIPVTLELGGKSPCIVHKDADIQLAAKRIVFGKFTNA
GQTCIAPDYLFVHEDIKTKLTEEMKRAIREFYGPQPERNPQYGKIVSERHYQRLLSFLND
GIPLTGGQSDPNHHKIAPTILEQVRDDSPVMQEEIFGPILPLFTYRNIGEVIEKVQSRPK
PLALYLFTTNKEIERAVLGNLSFGGGCVNDTLMHVATPYLPFGGVGESGIGSYHGFDSFN
TFTHKKSVVKQTNRFDFAFRYPSSKNGLRMIRKILK
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaacagcatcccctctatcatcagcaagcataaagcctattttgcggcgggacatacg
agaccgcttgaatcgagactgaacattttgcgaaagctgaaacaagccgtcagaactcat
gaagccgatctcatagccgctctctaccaggatctccataaatccgagcaagaagcatac
tcaacagaaatcggaatcgtcttggaggaaatcagctttgtcatgaaacggctgagaaaa
tggtccaagccgaaacgagtcaaaacgccgttgactcatctaggctccaaaagcatcatc
atccctgagccgtatggaaccgttttggtgattgcgccttggaactatcccttgcagctg
gcgctttctccgttgattggcgccattgcggcggggaacacggtcgttctcaagccatca
gaatatacgccggctgtttctgctattctttccaaactcatcagcagcgtttttccaact
gattatgtcgctatggcagaaggcgggcccgatgtcagcacagcattattacagcagccc
tttgactacattttctttaccggcagtgtagctgtaggaaaaatcgtcatggaggccgcc
gccaaacaattaattcccgtaaccttggagctcggcggcaaaagtccctgcatcgtccat
aaagatgctgacattcagcttgccgccaaacgcatcgtcttcgggaaatttacaaatgcg
ggacaaacctgcatcgcaccggattatttatttgtccacgaggacatcaaaacgaagctc
acagaagaaatgaagcgtgcgatcagagaattttacggccctcagccggaacggaatcca
cagtacggcaaaatcgtcagtgagcgccactatcagcggctgctcagctttctgaatgat
ggcatcccgctcacaggcggacaatctgatcccaatcatcacaaaattgcgccgaccatt
ctcgaacaagtgagagatgactctccagtgatgcaggaggagattttcgggccgattctt
ccgctctttacataccgcaatatcggggaagtcattgagaaagtccaatcgcgccctaag
ccgctcgccctgtatctcttcaccacaaacaaagaaattgagcgcgctgttttaggaaat
ctgtcgtttggcgggggctgtgtcaatgatacgttaatgcatgttgcgacgccgtatttg
ccattcggcggcgtcggggaaagcggcatcggcagctatcacgggtttgacagttttaac
acattcacgcacaaaaaaagcgtcgtcaaacaaacgaaccgtttcgacttcgcatttcgt
tatccttcctccaaaaacgggctgcgaatgattcgaaaaatactcaaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU38830
Entry
BSU38830          CDS       T00010                                 

Gene name
aldY
Definition
(RefSeq) aldehyde dehydrogenase AldY
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00053  Ascorbate and aldarate metabolism
bsu00071  Fatty acid degradation
bsu00280  Valine, leucine and isoleucine degradation
bsu00310  Lysine degradation
bsu00330  Arginine and proline metabolism
bsu00340  Histidine metabolism
bsu00380  Tryptophan metabolism
bsu00410  beta-Alanine metabolism
bsu00561  Glycerolipid metabolism
bsu00620  Pyruvate metabolism
bsu00625  Chloroalkane and chloroalkene degradation
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU38830 (aldY)
   00053 Ascorbate and aldarate metabolism
    BSU38830 (aldY)
   00620 Pyruvate metabolism
    BSU38830 (aldY)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSU38830 (aldY)
   00561 Glycerolipid metabolism
    BSU38830 (aldY)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU38830 (aldY)
   00310 Lysine degradation
    BSU38830 (aldY)
   00330 Arginine and proline metabolism
    BSU38830 (aldY)
   00340 Histidine metabolism
    BSU38830 (aldY)
   00380 Tryptophan metabolism
    BSU38830 (aldY)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSU38830 (aldY)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU38830 (aldY)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BSU38830 (aldY)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSU38830 (aldY)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BSU38830 (aldY)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 937414
NCBI-ProteinID: NP_391762
Pasteur: BG11903
BSORF: BG11903
UniProt: P94358 A0A6M3ZHV1
Structure
PDB: 
4DNG

Position
3986428..3987885
AA seq 485 aa
MSFETLNKSFINGKWTGGESGRTEDILNPYDQSVITTASLATGKQLEDAFDIAQKAQKEW
AKSTTEDRKAVLQKARGYLHENRDDIIMMIARETGGTIIKSTIELEQTIAILDEAMTYTG
ELGGVKEVPSDIEGKTNKIYRLPLGVISSISPFNFPMNLSMRSIAPAIALGNSVVHKPDI
QTAISGGTIIAKAFEHAGLPAGVLNVMLTDVKEIGDGMLTNPIPRLISFTGSTAVGRHIG
EIAGRAFKRMALELGGNNPFAVLSDADVDRAVDAAIFGKFIHQGQICMIINRIIVHQDVY
DEFVEKFTARVKQLPYGDQTDPKTVVGPLINERQIEKALEIIEQAKTDGIELAVEGKRVG
NVLTPYVFVGADNNSKIAQTELFAPIATIIKAGSDQEAIDMANDTEYGLSSAVFTSDLEK
GEKFALQIDSGMTHVNDQSVNDSPNIAFGGNKASGVGRFGNPWVVEEFTVTKWISIQKQY
RKYPF
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgagtttcgaaacgttaaacaaaagttttatcaacggaaaatggactgggggagaaagc
ggacgtacggaggacattttgaatccgtatgaccagtctgtgatcacaacagcatctttg
gcaacgggcaaacagcttgaggatgcgtttgacattgcacagaaagcccaaaaagagtgg
gccaagagcacgacggaagaccgaaaagccgtgctgcaaaaagcgcgcggctatttacac
gaaaaccgtgatgacatcattatgatgatcgcccgcgaaactggcggaacgatcattaaa
tcaacaatcgagctggaacaaacgattgcgattttagatgaagccatgacgtatactggt
gaattaggcggcgtcaaagaggtgccatccgacattgaagggaaaaccaataagatttac
cgccttccgctaggtgtcatttcatcgatttctccatttaatttcccaatgaatctatcc
atgagatccattgcgcccgcaattgcgctgggtaacagcgttgttcacaagcctgatatc
caaactgctatttccggcgggaccatcattgcgaaagcgtttgaacacgccggtcttcct
gccggtgtccttaacgtcatgctgacggatgtaaaggaaatcggggacggcatgctcacc
aatccaatcccgagattaatcagctttacagggtcaacagcagtcgggcgccacatcggt
gaaatcgccggtcgcgccttcaaacgaatggcacttgagctcggcggcaacaatccattt
gccgttctttcagatgcggatgtcgatcgtgctgtggatgccgcgattttcggaaaattt
attcaccagggacaaatctgtatgattatcaacaggatcatcgttcatcaagatgtatac
gatgagtttgtagaaaaattcaccgcccgtgtcaaacagcttccgtacggcgatcaaacc
gatccgaaaaccgttgtcggcccgctgatcaacgagcgccaaatcgagaaagcgctggag
atcattgagcaggcaaagacagacggcattgagcttgcggttgaaggaaaacgcgtcgga
aacgtgctgacgccgtacgtctttgtcggtgcggacaacaacagcaaaattgcccaaacg
gagctgtttgccccaatcgcaaccattattaaagctggcagcgaccaggaagcgattgac
atggcaaatgatactgaatacggcctcagctctgcggttttcacttctgatttagaaaaa
ggcgaaaagttcgccctgcaaattgacagcggcatgacccatgtcaacgaccagtccgtc
aatgattcgccgaatattgcctttggcggaaacaaagcaagcggtgtcggccgtttcggc
aatccgtgggtcgtcgaggaatttaccgtgacgaaatggatttcgatacagaagcaatac
cgcaaatatccgttctaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU39860
Entry
BSU39860          CDS       T00010                                 

Gene name
aldX
Definition
(RefSeq) aldehyde dehydrogenase AldX
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00053  Ascorbate and aldarate metabolism
bsu00071  Fatty acid degradation
bsu00280  Valine, leucine and isoleucine degradation
bsu00310  Lysine degradation
bsu00330  Arginine and proline metabolism
bsu00340  Histidine metabolism
bsu00380  Tryptophan metabolism
bsu00410  beta-Alanine metabolism
bsu00561  Glycerolipid metabolism
bsu00620  Pyruvate metabolism
bsu00625  Chloroalkane and chloroalkene degradation
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU39860 (aldX)
   00053 Ascorbate and aldarate metabolism
    BSU39860 (aldX)
   00620 Pyruvate metabolism
    BSU39860 (aldX)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSU39860 (aldX)
   00561 Glycerolipid metabolism
    BSU39860 (aldX)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU39860 (aldX)
   00310 Lysine degradation
    BSU39860 (aldX)
   00330 Arginine and proline metabolism
    BSU39860 (aldX)
   00340 Histidine metabolism
    BSU39860 (aldX)
   00380 Tryptophan metabolism
    BSU39860 (aldX)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSU39860 (aldX)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU39860 (aldX)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BSU39860 (aldX)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSU39860 (aldX)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BSU39860 (aldX)
SSDB
Motif
Pfam: Aldedh LuxC HXXSHH
Other DBs
NCBI-GeneID: 937653
NCBI-ProteinID: NP_391865
Pasteur: BG11355
BSORF: BG11355
UniProt: P46329 A0A6M3ZHS5
Position
4093980..4095317
AA seq 445 aa
MEQQVKDDIQRVFQLQKKQQKALRASTAEQRREKLQRFLDSVIAHEEEIIEAIRKDVRKP
YHEVKKAEIEGTKKAIRDNMNNLEQWMAPKEVGSSLSPDANGILMYEPKGVTLILGPWNY
PFMLTMAPLAASLAAGNSAIVKLSDFTMNTSNIAAKVIRDAFDEKEVAIFEGEVEVATEL
LDQPFDHIFFTGSTNVGKIVMTAAAKHLASVTLELGGKSPTIIDSEYDLMDAAKKIAVGK
FVNAGQTCIAPDYLFIKKDVQDRFAGILQTVVNAGFMEDDHTPDRSKFTQIVNDRNFNRV
KDLFDDAIERGAEVVFGGVFDASDRTISPTVLKNVTPDMKIMQEEIFASILPMMNYEDID
EVIDYVNDRDKPLALYVFSKNQDLIDNVLQHTTSGNAAINDVVVHFSDVNLPFGGVNTSG
IGSYHGVYGFKEFSHEKGVFIQAAE
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggaacagcaagtaaaggacgacatccagcgtgtctttcagcttcagaaaaaacagcaa
aaagccttgcgcgcttcaacagcggaacagcggagagaaaagcttcaacgctttttagat
tccgtcatcgcccatgaagaagaaatcatcgaagcgatccgcaaagacgtccgcaaacca
tatcacgaagtcaaaaaagcggaaatcgaaggaacaaaaaaagcgattagagataatatg
aataacctggaacaatggatggcgcctaaagaagtcggttcatcgttaagccctgacgca
aacggaattcttatgtacgagcctaaaggcgtcacactcatcctcggcccgtggaactat
ccgtttatgctgacgatggcgccgcttgccgcttctctcgcagccggaaacagcgcgatt
gtgaagctgtccgatttcacgatgaacacgagcaacattgctgctaaagtaataagagac
gcttttgatgaaaaagaagtcgcgatttttgaaggagaggttgaggtggcaaccgaacta
cttgatcagccgttcgaccatattttcttcactggaagcacaaatgtcgggaaaattgtc
atgacagcggctgccaaacacttggcatctgtcacacttgagcttggcggcaagagcccg
acgatcattgacagtgaatacgatctgatggacgcagcgaaaaagatcgccgtcgggaaa
ttcgtaaacgccggccaaacctgcatcgcacctgattacctgttcattaaaaaagacgtt
caggacaggttcgcggggattttacaaacagtcgtcaacgctggatttatggaggatgat
cataccccagaccgcagcaaatttacgcagatcgtcaatgaccgcaacttcaaccgcgtc
aaagatctgttcgacgatgccatcgaaagaggggcggaagtggtgttcggcggcgtattc
gatgccagcgaccgcacgatctcgccaaccgttttgaaaaacgtcacgcctgacatgaaa
atcatgcaggaggaaatcttcgcatcgatcctgccaatgatgaactatgaagacatcgac
gaggtcatcgattacgtaaatgaccgcgataaaccgcttgcactttatgtgttcagcaaa
aaccaagatctgattgacaacgtccttcagcacacgacatcaggaaatgccgccatcaat
gatgtcgtcgtccatttcagtgacgtcaacctgccattcggcggcgtcaacacaagcgga
atcggctcctatcatggggtatacggattcaaagagttttctcatgagaagggtgtattt
attcaggccgctgaataa

DBGET integrated database retrieval system