KEGG   Bacillus subtilis subsp. subtilis 168: BSU19630
Entry
BSU19630          CDS       T00010                                 

Gene name
deoD
Definition
(RefSeq) purine nucleoside phosphorylase DeoD-type
  KO
K03784  purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU19630 (deoD)
   00240 Pyrimidine metabolism
    BSU19630 (deoD)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU19630 (deoD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     BSU19630 (deoD)
SSDB
Motif
Pfam: PNP_UDP_1
Other DBs
NCBI-GeneID: 940038
NCBI-ProteinID: NP_389844
Pasteur: BG12581
BSORF: BG12581
UniProt: O34925 A0A6M4JKW7
Structure
PDB: 

Position
complement(2135470..2136171)
AA seq 233 aa
MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQ
GTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAF
GSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEME
TTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIEVALHSVSQ
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagtgtacatataggtgctgaaaaaggacaaattgcggatactgtgcttttgccggga
gatcctctcagagcaaaatttattgcagaaacgtatcttgaaaatgtagaatgctacaat
gaagtcagaggcatgtatggatttacgggtacatataaaggtaaaaaaatctcagtacaa
ggcacgggaatgggagttccgtctatttcaatttatgtgaatgaattaattcaaagctac
gatgtgcaaaatctaataagagtcggttcctgcggcgctattcgtaaagatgtcaaagtg
cgagacgtcattttggcgatgacctcctcaactgattcacaaatgaacagagttgctttc
ggaagcgttgattttgcgccttgcgcagatttcgagcttttaaaaaatgcctatgatgcc
gcaaaggataaaggtgtgccggtgactgtaggaagcgtatttacagctgaccagttctac
aatgacgattcgcaaattgaaaaacttgcaaaatacggtgtgcttggcgttgaaatggaa
acaactgcattgtatacattagcagcgaagcacggaagaaaagccctgtcaattctcacc
gtgagtgatcacgtattaacaggagaagaaacgacagcggaagagcgtcaaacgacattt
catgatatgatagaagtggctttacattccgtatcacaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU23490
Entry
BSU23490          CDS       T00010                                 

Gene name
pupG
Definition
(RefSeq) purine nucleoside phosphorylase 1
  KO
K03783  purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU23490 (pupG)
   00240 Pyrimidine metabolism
    BSU23490 (pupG)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU23490 (pupG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     BSU23490 (pupG)
SSDB
Motif
Pfam: PNP_UDP_1
Other DBs
NCBI-GeneID: 938731
NCBI-ProteinID: NP_390230
Pasteur: BG11330
BSORF: BG11330
UniProt: P46354 A0A6M3ZDN2
Position
complement(2446418..2447233)
AA seq 271 aa
MKDRIERAAAFIKQNLPESPKIGLILGSGLGILADEIENPVKLKYEDIPEFPVSTVEGHA
GQLVLGTLEGVSVIAMQGRFHFYEGYSMEKVTFPVRVMKALGVEALIVTNAAGGVNTEFR
AGDLMIITDHINFMGTNPLIGPNEADFGARFPDMSSAYDKDLSSLAEKIAKDLNIPIQKG
VYTAVTGPSYETPAEVRFLRTMGSDAVGMSTVPEVIVANHAGMRVLGISCISNAAAGILD
QPLSHDEVMEVTEKVKAGFLKLVKAIVAQYE
NT seq 816 nt   +upstreamnt  +downstreamnt
ttgaaggacagaattgaacgcgcagccgcttttattaaacaaaacctgccggaatctcca
aagatcggccttattttaggctcaggtcttggcattttggcggacgaaatcgaaaatccg
gtcaagctgaaatatgaagatatacctgaattcccggtatctactgttgaagggcatgcc
ggacagcttgtgcttggcactcttgaaggagtttccgtcattgcaatgcagggccgcttt
catttttatgaaggctactcaatggagaaagtcacattccctgtacgcgtgatgaaagcg
ctcggtgtggaagcgttgatcgtgacaaatgccgcaggcggtgtcaacactgaattccgt
gcgggagatttaatgattattaccgatcatatcaactttatgggaacaaacccgttaatc
gggccaaacgaagcagatttcggcgccagatttccagatatgtcttcagcctatgacaaa
gatctgtccagcctggctgaaaagattgcgaaagaccttaatatcccaattcaaaaaggc
gtgtacactgctgtgacaggaccttcttacgaaacaccggcagaagtccgtttcttaaga
acgatgggctctgatgcagtcggcatgtctactgttccggaagtcattgtagcgaatcat
gcgggaatgcgggttcttggcatttcctgcatctctaacgcggcagccggaattctggat
cagcctttaagtcacgatgaagttatggaagtgaccgaaaaagtaaaagctggattctta
aagcttgttaaagcgatcgtcgctcagtacgaataa

DBGET integrated database retrieval system