KEGG   Bacillus subtilis subsp. subtilis 168: BSU22230
Entry
BSU22230          CDS       T00010                                 

Symbol
ypqE
Name
(RefSeq) PTS system transporter subunit IIA YpqE
  KO
K02777  sugar PTS system EIIA component [EC:2.7.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU22230 (ypqE)
   00500 Starch and sucrose metabolism
    BSU22230 (ypqE)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU22230 (ypqE)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU22230 (ypqE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU22230 (ypqE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     BSU22230 (ypqE)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component
    BSU22230 (ypqE)
   N-Acetylglucosamine-specific II component
    BSU22230 (ypqE)
   Maltose/glucose-specific II component
    BSU22230 (ypqE)
   Beta-glucoside (arbutin/salicin/cellobiose)-specific II component
    BSU22230 (ypqE)
   Trehalose-specific II component
    BSU22230 (ypqE)
   N-Acetylmuramic acid-specific II component
    BSU22230 (ypqE)
   Alpha-glucoside-specific II component
    BSU22230 (ypqE)
SSDB
Motif
Pfam: PTS_EIIA_1 Peptidase_M23 Biotin_lipoyl PYNP_C Biotin_lipoyl_2
Other DBs
NCBI-GeneID: 939046
NCBI-ProteinID: NP_390105
Pasteur: BG11450
BSORF: BG11450
UniProt: P50829 A0A6M3ZD67
Position
complement(2336933..2337439)
AA seq 168 aa
MLKKLFGMGKIQEKVTEEVIYSPADGTVMDLSDVPDPVFSQKMMGEGIAVEPSSGEIVSP
AEGEVIQIFHTKHAVGIRTRSGIELLIHVGLETVNMNGEGFTAHIKEGDKVKVGDPLITC
DLELIKEKASSTVIPIVIMNGEAVGSMVSAGEKAARKGESKLFTIKAK
NT seq 507 nt   +upstreamnt  +downstreamnt
ttgctgaaaaaattattcggaatgggcaaaattcaggaaaaggtgacagaagaggttatt
tattctccggcagacggtacagtaatggacctgtcagatgtaccggaccctgttttttca
cagaaaatgatgggagaaggaatagcggtggaaccttctagcggtgaaatcgtttctccc
gctgaaggtgaagtcattcagattttccacaccaaacacgccgttggcattcggactcgc
tcgggaattgagctgttaattcatgtcgggctggagacagtcaatatgaacggagaagga
tttactgcccacattaaagaaggggataaagtgaaggtcggtgacccgctgattacatgt
gatttggaattaataaaagaaaaagcgagcagcacagtcatcccaatcgttataatgaat
ggtgaggctgtaggatcaatggtatcggcaggcgaaaaggctgctcgtaaaggcgaatca
aagctctttacaataaaagcgaaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU40120
Entry
BSU40120          CDS       T00010                                 

Symbol
yyzE
Name
(RefSeq) PTS system transporter subunit IIA YyzE
  KO
K02777  sugar PTS system EIIA component [EC:2.7.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU40120 (yyzE)
   00500 Starch and sucrose metabolism
    BSU40120 (yyzE)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU40120 (yyzE)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU40120 (yyzE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU40120 (yyzE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     BSU40120 (yyzE)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component
    BSU40120 (yyzE)
   N-Acetylglucosamine-specific II component
    BSU40120 (yyzE)
   Maltose/glucose-specific II component
    BSU40120 (yyzE)
   Beta-glucoside (arbutin/salicin/cellobiose)-specific II component
    BSU40120 (yyzE)
   Trehalose-specific II component
    BSU40120 (yyzE)
   N-Acetylmuramic acid-specific II component
    BSU40120 (yyzE)
   Alpha-glucoside-specific II component
    BSU40120 (yyzE)
SSDB
Motif
Pfam: PTS_EIIA_1 Biotin_lipoyl_2 NQRA Biotin_lipoyl YqfD QRPTase_N PYNP_C
Other DBs
NCBI-GeneID: 937724
NCBI-ProteinID: NP_391892
Pasteur: BG14172
BSORF: BG14172
UniProt: O32292
Position
complement(4122619..4122849)
AA seq 76 aa
MVTPTKHAIGLRSASGVELLAHIGLDTVTFDGTPFSLKVKEGDTVKKGEVLVEFDKAFIE
DIEESALHQKIFTVVS
NT seq 231 nt   +upstreamnt  +downstreamnt
atggttacgcctacaaagcatgcgattggcctgcgttcagcgtccggcgtcgaattgctt
gcgcacatcgggctggatacggtgacatttgacggcacgcctttttccttgaaggtaaaa
gaaggcgataccgtcaaaaaaggcgaagtgcttgttgagtttgataaagctttcattgaa
gacattgaggaaagtgcattacatcaaaaaatatttacagtcgtaagctga

DBGET integrated database retrieval system