KEGG   Bacillus subtilis subsp. subtilis 168: BSU22560
Entry
BSU22560          CDS       T00010                                 
Symbol
qcrA
Name
(RefSeq) menaquinol-cytochrome c reductase iron-sulfur subunit
  KO
K03886  menaquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU22560 (qcrA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.2  With a cytochrome as acceptor
    1.10.2.-
     BSU22560 (qcrA)
SSDB
Motif
Pfam: Rieske UCR_Fe-S_N
Other DBs
NCBI-GeneID: 939017
NCBI-ProteinID: NP_390137
Pasteur: BG11325
UniProt: P46911 A3F397
Position
complement(2364589..2365092)
AA seq 167 aa
MGGKHDISRRQFLNYTLTGVGGFMAASMLMPMVRFALDPVLKSTGKQDMVQVVSVDELTK
EPQRFDFKINQVDAWYESEESRSAWVFKNGDEIVALSPICKHLGCTVNWNSDPKNPNKFF
CPCHYGLYEKDGTNVPGTPPLAPLDHYEQEVKDGFLYLGKAKPKGEG
NT seq 504 nt   +upstreamnt  +downstreamnt
atgggcggaaaacatgatatatccagacgtcaatttttgaattatacgctcacaggcgta
ggaggttttatggcggctagtatgctcatgcctatggttcgcttcgcactcgacccggta
ttaaaatcgacagggaagcaggatatggttcaggttgtcagcgttgatgagttgacaaaa
gagccgcagcgctttgattttaaaattaatcaagtcgatgcctggtatgagtcagaagag
tcaagatcagcctgggtcttcaaaaacggggatgaaattgtagcactttcgccaatttgt
aagcatttagggtgtacggtgaactggaatagtgatcctaaaaacccgaataaattcttt
tgtccatgccattacggactctatgaaaaggacggcaccaatgtccctggcacgccgccg
cttgcgcctcttgatcattatgagcaagaagtaaaagacggcttcctgtatcttggaaaa
gcaaagcctaagggggaagggtga

DBGET integrated database retrieval system