KEGG   Bacillus subtilis subsp. subtilis 168: BSU22730
Entry
BSU22730          CDS       T00010                                 
Symbol
ndk
Name
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01232  Nucleotide metabolism
bsu01240  Biosynthesis of cofactors
Module
bsu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
bsu_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
bsu_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
bsu_M00053  Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP
bsu_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU22730 (ndk)
   00240 Pyrimidine metabolism
    BSU22730 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bsu04131]
    BSU22730 (ndk)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     BSU22730 (ndk)
Membrane trafficking [BR:bsu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    BSU22730 (ndk)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 938997
NCBI-ProteinID: NP_390154
Pasteur: BG10282
UniProt: P31103 A3F3D6
Position
complement(2381354..2381803)
AA seq 149 aa
MMEKTFIMVKPDGVQRQLIGDILSRFERKGLQLAGAKLMRVTEQMAEKHYAEHQGKPFFG
ELVEFITSGPVFAMVWEGENVIEVTRQLIGKTNPKEALPGTIRGDYGMFVGKNIIHGSDS
LESAEREINIFFKNEELVSYQQLMAGWIY
NT seq 450 nt   +upstreamnt  +downstreamnt
atgatggaaaagacttttatcatggtgaaaccagacggtgtccaacgtcagctcattggg
gacattttatctagattcgaacgtaagggcttacaattagctggcgccaagttaatgaga
gtgactgaacaaatggctgagaaacactacgccgaacatcaaggtaagcctttcttcgga
gagctcgttgagtttattacttcaggacctgtattcgcaatggtgtgggaaggcgaaaat
gtcattgaagtgacgagacagctgatcgggaaaacaaaccctaaagaagctttacctggt
acgattcgtggggattatggcatgtttgtcggaaaaaacatcatccacggctctgattct
ctcgaaagtgcagaacgcgagattaacattttctttaagaatgaagaattagtatcatat
cagcagcttatggcaggctggatctattaa

DBGET integrated database retrieval system