KEGG   Bacillus subtilis subsp. subtilis 168: BSU22730
Entry
BSU22730          CDS       T00010                                 

Gene name
ndk
Definition
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
bsu_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
bsu_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
bsu_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP => dCTP
bsu_M00938  Pyrimidine deoxyribonuleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU22730 (ndk)
   00240 Pyrimidine metabolism
    BSU22730 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bsu04131]
    BSU22730 (ndk)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     BSU22730 (ndk)
Membrane trafficking [BR:bsu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    BSU22730 (ndk)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 938997
NCBI-ProteinID: NP_390154
Pasteur: BG10282
BSORF: BG10282
UniProt: P31103 A3F3D6
Position
complement(2381354..2381803)
AA seq 149 aa
MMEKTFIMVKPDGVQRQLIGDILSRFERKGLQLAGAKLMRVTEQMAEKHYAEHQGKPFFG
ELVEFITSGPVFAMVWEGENVIEVTRQLIGKTNPKEALPGTIRGDYGMFVGKNIIHGSDS
LESAEREINIFFKNEELVSYQQLMAGWIY
NT seq 450 nt   +upstreamnt  +downstreamnt
atgatggaaaagacttttatcatggtgaaaccagacggtgtccaacgtcagctcattggg
gacattttatctagattcgaacgtaagggcttacaattagctggcgccaagttaatgaga
gtgactgaacaaatggctgagaaacactacgccgaacatcaaggtaagcctttcttcgga
gagctcgttgagtttattacttcaggacctgtattcgcaatggtgtgggaaggcgaaaat
gtcattgaagtgacgagacagctgatcgggaaaacaaaccctaaagaagctttacctggt
acgattcgtggggattatggcatgtttgtcggaaaaaacatcatccacggctctgattct
ctcgaaagtgcagaacgcgagattaacattttctttaagaatgaagaattagtatcatat
cagcagcttatggcaggctggatctattaa

DBGET integrated database retrieval system