KEGG   Bacillus subtilis subsp. subtilis 168: BSU22880
Entry
BSU22880          CDS       T00010                                 

Symbol
rpsA
Name
(RefSeq) 30S ribosomal protein S1
  KO
K02945  small subunit ribosomal protein S1
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU22880 (rpsA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU22880 (rpsA)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    BSU22880 (rpsA)
SSDB
Motif
Pfam: S1 DUF2110 S1_2 EXOSC1 Xylo_C PCB_OB
Other DBs
NCBI-GeneID: 938986
NCBI-ProteinID: NP_390169
Pasteur: BG11005
BSORF: BG11005
UniProt: P38494 A0A6M4JNA5
Position
complement(2394664..2395812)
AA seq 382 aa
MTEEMNQIDVQVPEVGDVVKGIVTKVEDKHVDVEIINVKQSGIIPISELSSLHVEKASDV
VKVDDELDLKVTKVEDDALILSKRAVDADRAWEDLEKKFETKEVFEAEVKDVVKGGLVVD
IGVRGFIPASLVEAHFVEDFTDYKGKTLSLLVVELDRDKNRVILSHRAVVESEQANKKQE
LLQSLEVGSVLDGKVQRLTDFGAFVDIGGIDGLVHISQLSHSHVEKPSDVVEEGQEVKVK
VLSVDRDNERISLSIKDTLPGPWNQIGEKVKPGDVLEGTVQRLVSFGAFVEILPGVEGLV
HISQISNKHIGTPHEVLEEGQTVKVKVLDVNENEERISLSMRELEETPKADQEDYRQYQA
KEETSTGFQLGDLIGDKLNKLK
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgacagaggaaatgaatcaaattgatgttcaagtgccagaggttggagatgtagttaaa
gggattgtgacaaaggtagaagacaaacatgtagatgtagaaattatcaatgtcaaacaa
tccggtattattccaatcagtgaattatcaagtcttcatgtagagaaagcatcggatgtt
gttaaagtagacgacgagcttgacctgaaagtaacaaaagtggaagacgatgctttgatt
ttatctaaacgtgctgttgatgcagaccgcgcttgggaagaccttgagaaaaaatttgaa
acaaaagaagtgtttgaagctgaagtgaaagatgtcgtgaaaggcggccttgtcgttgat
atcggcgttcgcggttttattccggcatcacttgttgaagcacatttcgttgaagacttc
actgactataaaggaaaaacactgtcactgctcgttgtagagcttgaccgtgataaaaac
cgcgtgatcctttcacaccgtgctgttgttgaaagtgaacaagcgaataaaaaacaagaa
cttcttcagtctcttgaagttggaagtgtacttgatggcaaagtacagcgcctgactgac
tttggcgcgtttgttgatattggcggcatcgacggacttgtacacatttcacagctttcc
cactctcatgtagagaagccgtctgacgttgttgaagagggacaagaagtaaaagtgaaa
gtgttatcggttgaccgtgataatgaacgtatttctttatcgatcaaagatacactgcct
ggaccttggaaccaaatcggcgaaaaagtgaagcctggcgatgtgcttgaaggaactgta
cagcgtcttgtaagcttcggtgcctttgttgaaatccttccaggtgttgaaggtctcgtt
catatttctcaaatttccaataaacacatcggcacgccgcatgaagtccttgaagaagga
cagactgtaaaagtgaaggttcttgatgtgaatgaaaatgaggagcgcatttcattaagc
atgcgtgaacttgaagaaacgcctaaagctgaccaggaagattaccgtcaatatcaagcg
aaggaagaaacaagcactggcttccagcttggagatctgatcggagataagctgaataaa
ctaaaataa

DBGET integrated database retrieval system