KEGG   Bacillus subtilis subsp. subtilis 168: BSU23270
Entry
BSU23270          CDS       T00010                                 

Symbol
ribE
Name
(RefSeq) riboflavin synthase
  KO
K00793  riboflavin synthase [EC:2.5.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00740  Riboflavin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSU23270 (ribE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.9  riboflavin synthase
     BSU23270 (ribE)
SSDB
Motif
Pfam: Lum_binding DUF2291
Other DBs
NCBI-GeneID: 938947
NCBI-ProteinID: NP_390208
Pasteur: BG10519
BSORF: BG10519
UniProt: P16440 A0A6M4JKD0
Position
complement(2429600..2430247)
AA seq 215 aa
MFTGIIEETGTIESMKKAGHAMALTIKCSKILEDVHLGDSIAVNGICLTVTDFTKNQFTV
DVMPETVKATSLNDLTKGSKVNLERAMAANGRFGGHFVSGHVDGTAEITRIEEKSNAVYY
DLKMDPSLTKTLVLKGSITVDGVSLTIFGLTEDTVTISLIPHTISETIFSEKTIGSKVNI
ECDMIGKYMYRFLHKANENKTQQTITKAFLSENGF
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtttacaggaattatcgaagaaacaggcacaatcgaatccatgaaaaaagcagggcat
gcaatggccttaactattaaatgctcaaagattttagaggatgttcatcttggcgacagc
attgcagtgaacggcatttgtctgactgtcactgattttacaaaaaatcaattcacagtg
gatgttatgcctgaaacagtcaaagctacgtcactgaatgatttaacaaaaggaagcaaa
gtaaatctggaaagagcgatggcggcaaacggccgtttcggaggccatttcgtctcaggc
catgtcgacggaactgcggaaatcacacgaattgaagagaaaagcaacgcagtttactat
gatttaaaaatggacccgtcattaacaaaaacattggttttaaagggatcaattactgtg
gatggcgtgagcttaaccatattcggcctgacagaagacacagtgacgatctccttaata
ccgcatacgatcagcgaaacgatcttttcagaaaaaacgatcggctctaaagtgaatatc
gaatgcgatatgatcggaaaatatatgtatcgatttttgcataaagccaatgaaaataag
acccaacaaaccattacaaaagccttcttaagcgaaaacggcttttag

DBGET integrated database retrieval system