KEGG   Bacillus subtilis subsp. subtilis 168: BSU23500
Entry
BSU23500          CDS       T00010                                 

Gene name
drm
Definition
(RefSeq) phosphopentomutase
  KO
K01839  phosphopentomutase [EC:5.4.2.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU23500 (drm)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU23500 (drm)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.7  phosphopentomutase
     BSU23500 (drm)
SSDB
Motif
Pfam: Metalloenzyme Sulfatase Phosphodiest
Other DBs
NCBI-GeneID: 938728
NCBI-ProteinID: NP_390231
Pasteur: BG11331
BSORF: BG11331
UniProt: P46353 A0A6M4JJ03
Position
complement(2447246..2448430)
AA seq 394 aa
MPAYKYNRVFLIVMDSVGIGEAPDAADFNDEGAHTLGHIAEHMNGLHMPNMAKLGLGLIE
DIKGVEKTEHPLAYYGKMQEASNGKDTMTGHWEIMGLYIDKPFKVFPEGFPDELLQELEK
RSGRKIIGNKPASGTAILDELGQEHMETGALIVYTSADSVLQIAAHEEVVPLEELYRICE
TARELTLDPKYMVGRIIARPFVGEPGQFKRTPNRHDYALKPFDRTVMNELKDCGLDVISI
GKISDIYDGEGITSSRRTVSNMDGMDKVIDTLGEDFTGLSFANLVDFDALFGHRRDPEGY
GRALEEFDARLPEVFEKMREDDLLIITADHGNDPIHHGTDHTREYVPILAYSKKHKKAQM
LPLADTFADIGATIADNFQTNKPKYGKSFLSLLQ
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgcctgcatacaaatataatcgtgtgtttttaattgtgatggactcagtcggaatcggc
gaagcgccggatgccgctgactttaatgacgaaggcgctcatacgctcggtcatattgcc
gagcatatgaacggattacatatgccgaatatggcaaagctcggccttggtcttatcgaa
gatatcaaaggtgtagaaaaaacagaacatccgcttgcctattatggaaaaatgcaagaa
gcgtcaaacggcaaagatacgatgaccggccattgggagattatgggtttatacattgat
aaaccgtttaaagtgttcccggaaggctttcctgatgaattgcttcaagagctggaaaag
agatctggccgcaaaattattggaaacaagccggcttccggcacagcgattttggatgag
cttggccaggagcacatggagacaggggctttaattgtttacacgtctgctgactctgtt
ctgcaaattgccgctcacgaagaggttgtgccgcttgaggagctgtatcgcatttgcgaa
acggcgagagagctgacgcttgatccgaaatatatggttggccgcattattgcacggccg
ttcgtcggagagccgggtcaattcaaacggacgccaaaccgccatgattatgcgctgaag
ccgtttgaccgcactgtcatgaatgaattgaaagactgcggcttagatgtgatttcaatc
ggtaaaatctctgatatttacgacggagaaggcattacttcttcacgcagaacggtttct
aatatggacggaatggacaaggtgatcgatacgctgggagaagattttacgggtctgagc
tttgcgaaccttgttgattttgacgcgttattcggacaccgccgtgaccctgaaggctac
ggacgcgcgcttgaagaatttgatgcgcggcttccggaagtgtttgaaaaaatgagagaa
gacgatctgttaattattacagccgaccacggcaatgatccgattcatcatgggactgac
catacacgcgagtatgtgccgattctcgcttacagcaaaaaacataagaaagcgcaaatg
ctgccgcttgcagatacatttgccgatattggcgcaacgatcgctgataatttccaaaca
aataaaccgaaatacgggaaaagctttttatctttattacaatag

DBGET integrated database retrieval system