KEGG   Bacillus subtilis subsp. subtilis 168: BSU23610
Entry
BSU23610          CDS       T00010                                 

Gene name
nudF
Definition
(RefSeq) adp-ribose pyrophosphatase
  KO
K01515  ADP-ribose pyrophosphatase [EC:3.6.1.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU23610 (nudF)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     BSU23610 (nudF)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 938719
NCBI-ProteinID: NP_390242
Pasteur: BG11762
BSORF: BG11762
UniProt: P54570 A0A6M4JND5
Position
complement(2458509..2459066)
AA seq 185 aa
MKSLEEKTIAKEQIFSGKVIDLYVEDVELPNGKASKREIVKHPGAVAVLAVTDEGKIIMV
KQFRKPLERTIVEIPAGKLEKGEEPEYTALRELEEETGYTAKKLTKITAFYTSPGFADEI
VHVFLAEELSVLEEKRELDEDEFVEVMEVTLEDALKLVESREVYDAKTAYAIQYLQLKEA
LQAQK
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaaatcattagaagaaaaaacaattgccaaagaacagattttttcgggtaaagtcatt
gatctttatgtcgaggatgtagagctgccaaacggcaaagccagtaaacgtgaaattgtg
aaacaccctggagctgtagcggtactagccgtcacagatgaagggaaaatcatcatggtc
aaacaattccgtaagccgcttgagcggacgatcgttgaaattccggccggtaagcttgaa
aaaggtgaggagccggagtatacggcacttcgggaacttgaagaggaaaccggttataca
gcaaaaaaactgacaaaaataactgcgttttatacatcacccggatttgcagatgaaatc
gttcacgtttttcttgctgaggagctttctgtgcttgaagaaaaacgggagcttgatgag
gacgagtttgttgaagtgatggaggtgacgcttgaagatgcgctaaagctggttgaatcg
cgtgaagtatatgatgctaaaacagcctacgcgattcagtatcttcagctgaaagaagcg
ctccaagcacaaaaatga

DBGET integrated database retrieval system