KEGG   Bacillus subtilis subsp. subtilis 168: BSU23770
Entry
BSU23770          CDS       T00010                                 

Symbol
dsdA
Name
(RefSeq) D-serine dehydratase
  KO
K01753  D-serine dehydratase [EC:4.3.1.18]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00470  D-Amino acid metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU23770 (dsdA)
  09106 Metabolism of other amino acids
   00470 D-Amino acid metabolism
    BSU23770 (dsdA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     BSU23770 (dsdA)
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-GeneID: 938700
NCBI-ProteinID: NP_390258
Pasteur: BG11747
BSORF: BG11747
UniProt: P54555 A0A6M4JM76
Position
complement(2469580..2470926)
AA seq 448 aa
MSVHSEVLHALLKDPFIQKLIDAEPVFWANSGKKEGPLPRADEWATEIAEAEKRMQRFAP
YIAEVFPETKGAKGIIESPLFEVQHMKGKLEAAYQQPFPGRWLLKCDHELPISGSIKARG
GIYEVLKYAENLALQEGMLQETDDYRILQEERFTGFFSRYSIAVGSTGNLGLSIGIIGAA
LGFRVTVHMSADAKQWKKDLLRQKGVTVMEYETDYSEAVNEGRRQAEQDPFCYFIDDEHS
RQLFLGYAVAASRLKTQLDCMNIKPSLETPLFVYLPCGVGGGPGGVAFGLKLLYGDDVHV
FFAEPTHSPCMLLGLYSGLHEKISVQDIGLDNQTAADGLAVGRPSGFVGKLIEPLLSGCY
TVEDNTLYTLLHMLAVSEDKYLEPSALAGMFGPVQLFSTEEGRRYAQKYKMEHAVHVVWG
TGGSMVPKDEMAAYNRIGADLLKKRNEK
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtcagttcattcagaagtccttcatgctctgcttaaagatccgtttattcagaaactg
attgatgcagagcctgtattctgggcaaattcaggcaagaaagaggggccattaccccgt
gcagatgagtgggcaaccgagatagcggaagcggaaaaaagaatgcagcggtttgcacct
tacattgccgaggtgtttcctgagacgaaaggcgctaaaggaatcatcgagtctccgctt
tttgaggtgcagcatatgaagggaaagctggaagcggcatatcagcagccatttcccgga
agatggcttttaaagtgcgaccatgagcttccgatttcaggatcgattaaagcgaggggc
gggatttatgaagtgttaaagtatgctgaaaatctcgcgcttcaagaaggaatgcttcag
gaaaccgatgattaccgcatcttacaggaagagcggtttaccgggtttttctcccgctat
tcgattgctgtcggttcgacaggaaatctaggtttaagcatcggcatcatcggcgcggca
ctcgggtttcgcgtgacagtgcatatgtccgccgatgctaagcagtggaaaaaggatctc
ctccgccaaaagggagtcactgttatggagtacgaaacagattacagtgaagcggtgaac
gaagggagacggcaggcggaacaagatccattctgttattttattgatgatgaacattct
cgtcagctgttcttaggatatgctgttgctgcaagccgattaaaaacacagcttgactgt
atgaatataaagccaagtcttgagacgcccttgtttgtgtatctgccgtgcggagtcggc
ggaggaccgggcggtgtagcatttgggctgaagcttttatacggagatgatgttcatgtg
tttttcgcagaaccaactcattcaccttgtatgctgttagggctttattcaggacttcac
gagaagatctccgtccaggatatcggcctggataatcagacggctgctgacggacttgcc
gtagggaggccgtcaggatttgtcggcaagctgattgaaccgcttctgagcggctgttat
acggtagaggacaatacgctttatactttgcttcatatgctggctgtatctgaagataaa
tatttagagccctctgctcttgctggcatgttcgggccggttcagcttttttcgacagaa
gagggaaggcgctatgctcagaaatataagatggaacatgccgtacatgtcgtctgggga
acgggaggaagcatggttccaaaagatgaaatggctgcgtataaccgaatcggtgctgat
ttgctaaaaaaacgaaatgaaaaataa

DBGET integrated database retrieval system