KEGG   Bacillus subtilis subsp. subtilis 168: BSU23970
Entry
BSU23970          CDS       T00010                                 

Symbol
artQ
Name
(RefSeq) arginine transport system permease protein ArtQ
  KO
K17077  arginine/lysine/histidine transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU23970 (artQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU23970 (artQ)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Arginine/lysine/histidine transporter
    BSU23970 (artQ)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 938678
NCBI-ProteinID: NP_390277
Pasteur: BG11728
BSORF: BG11728
UniProt: P54536 A0A6M4JKJ4
Position
complement(2491289..2491948)
AA seq 219 aa
MNLDFSATIPQIPFILEGLAITLKIVVVSAIIGLILGIVLSLCKISTFRPFIWIADFYTS
VFRGTPLVLQLMIVYFGLPQLLGFQIDQFWAAVVALSLNSAAYVSEIIRAGINAIDKGQK
EAAVALGVPYGKMMKDLLLPQAFKNISPAIVNELITLTKESAIVTVIGLGDVMRRAYQAG
AATYNYLEPLIIAGLIYYVLVLILTFIGKAVERKLKSND
NT seq 660 nt   +upstreamnt  +downstreamnt
atgaatttggatttttcagcaacgatcccccaaattccttttatattagaaggcttggca
attacattaaaaattgttgttgtatctgctattatcggacttatactcggtattgtgcta
agcttatgcaagatcagcacattccgcccgtttatctggatcgctgatttttatacatca
gtgttccgaggcacgcctttagtgctgcagcttatgattgtctattttggccttcctcag
ctgctcggatttcaaattgaccagttttgggctgcggttgtcgcattgtctttgaattcc
gccgcttatgtatcggaaattatcagagccggaatcaatgccattgataaagggcaaaaa
gaagctgctgttgcactcggtgtcccgtatggaaaaatgatgaaggatctgctgctgccg
caggccttcaaaaatatatcacctgcaattgtgaatgaattaattacgttaacaaaagaa
tcggcgatcgtcaccgtcatcgggcttggtgatgtcatgagacgcgcatatcaagctggc
gccgccacttacaattaccttgagccgctcattatcgcgggattgatttattatgtgctt
gtcctgattttaacgtttatcggcaaggctgtagaaaggaagctgaaatccaatgattaa

DBGET integrated database retrieval system