KEGG   Bacillus subtilis subsp. subtilis 168: BSU24080
Entry
BSU24080          CDS       T00010                                 

Symbol
bcd
Name
(RefSeq) leucine dehydrogenase
  KO
K00263  leucine dehydrogenase [EC:1.4.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00280  Valine, leucine and isoleucine degradation
bsu00290  Valine, leucine and isoleucine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU24080 (bcd)
   00290 Valine, leucine and isoleucine biosynthesis
    BSU24080 (bcd)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.9  leucine dehydrogenase
     BSU24080 (bcd)
SSDB
Motif
Pfam: ELFV_dehydrog_N ELFV_dehydrog 2-Hacid_dh_C AdoHcyase_NAD adh_short_C2 NAD_binding_7 NAD_binding_2 TrkA_N Shikimate_DH F420_oxidored IlvN adh_short UPF0146
Other DBs
NCBI-GeneID: 938670
NCBI-ProteinID: NP_390288
Pasteur: BG11723
BSORF: BG11723
UniProt: P54531 A0A6M3ZDN9
Position
complement(2502659..2503753)
AA seq 364 aa
MELFKYMEKYDYEQLVFCQDEQSGLKAIIAIHDTTLGPALGGTRMWTYENEEAAIEDALR
LARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEEMFRAFGRYIQGLNGRYITAEDVGTTV
EDMDIIHDETDYVTGISPAFGSSGNPSPVTAYGVYRGMKAAAKAAFGTDSLEGKTIAVQG
VGNVAYNLCRHLHEEGANLIVTDINKQSVQRAVEDFGARAVDPDDIYSQDCDIYAPCALG
ATINDDTIKQLKAKVIAGAANNQLKETRHGDQIHEMGIVYAPDYVINAGGVINVADELYG
YNAERALKKVEGIYGNIERVLEISQRDGIPAYLAADRLAEERIERMRRSRSQFLQNGHSV
LSRR
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggaactttttaaatatatggagaaatacgattacgaacaattggtattctgccaggat
gaacaatctggattaaaagcgattatcgccattcatgatacaacgcttggtccggcgctt
ggcggaacgagaatgtggacatatgaaaatgaagaagcggcaattgaagatgcgctcaga
ttggcaagaggcatgacctataagaacgcggcggcaggcttaaaccttggcggcggaaaa
acagtcattatcggcgatccgcgcaaagacaaaaatgaggaaatgttccgcgcgtttggc
cgctatattcaaggactgaatggcagatacatcacggctgaagatgtgggcacaacggtc
gaggatatggatatcattcatgatgagacagactatgtcacagggatttctcctgctttc
ggctcttctggaaatccgtccccagtcacagcgtacggggtgtacagaggaatgaaggca
gcagctaaagctgctttcggaaccgactctcttgaaggaaaaaccattgctgtacagggt
gttgggaacgtagcctataacctttgccgccacctgcatgaagaaggagcaaacttaatc
gttacggatatcaacaaacaatctgtacagcgtgcagttgaagattttggcgcccgtgcg
gtagatcctgatgacatttattcacaagactgcgatatttatgcgccgtgtgcccttggt
gcgactattaacgacgacaccattaaacagctgaaggcgaaagtgatcgcaggtgcggct
aacaaccaattaaaagagacacgccatggtgatcaaattcacgaaatgggcatcgtttat
gcaccggattacgtgattaacgcgggcggtgtcatcaacgtggcagatgagctttacggc
tataatgcagaacgtgcattgaaaaaagttgaaggcatttacggcaatatcgagcgtgta
cttgagatttctcagcgtgacggcattcctgcatatttagcggctgaccgcttagcagag
gaacggattgaacgcatgcgccgctcaagaagccagtttttgcaaaacggccacagtgta
ttaagcagacgttaa

DBGET integrated database retrieval system