KEGG   Bacillus subtilis subsp. subtilis 168: BSU24530
Entry
BSU24530          CDS       T00010                                 

Gene name
yqhM
Definition
(RefSeq) octanoyltransferase LipM
  KO
K23734  lipoyl(octanoyl) transferase [EC:2.3.1.181]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00785  Lipoic acid metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00883  Lipoic acid biosynthesis, animals and bacteria, octanoyl-ACP => dihydrolipoyl-H => dihydrolipoyl-E2
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    BSU24530 (yqhM)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.181  lipoyl(octanoyl) transferase
     BSU24530 (yqhM)
SSDB
Motif
Pfam: BPL_LplA_LipB
Other DBs
NCBI-GeneID: 938551
NCBI-ProteinID: NP_390333
Pasteur: BG11701
BSORF: BG11701
UniProt: P54511 A0A6M4JJ11
Position
complement(2543968..2544804)
AA seq 278 aa
MQKETWRFIDSGNASPAFNMALDEALLYWHSEKKIPPVIRFYGWNPATLSVGYFQNIKKE
INFEAVHKYNLGFVRRPTGGRGVLHDQELTYSVIVSEEHPEMPATVTEAYRVISEGILQG
FRNLGLDAYFAIPRTEKEKESLKNPRSSVCFDAPSWYELVVEGRKVAGSAQTRQKGVILQ
HGSILLDLDEDKLFDLFLYPSERVRERMQRNFKNKAVAINELIEKRVTMDEARKAFKEGF
ETGLNIHLEPYELSQEELDFVHHLAETKYASDEWNYKR
NT seq 837 nt   +upstreamnt  +downstreamnt
atgcaaaaagaaacttggcggtttatagactcaggcaatgcaagtcctgcattcaatatg
gcgcttgatgaagcgcttttatattggcacagcgaaaagaaaatccccccggttatccgt
ttttacggctggaatccggcgacactttctgtagggtattttcaaaatattaaaaaggaa
atcaattttgaagcagtacataaatataatctcggattcgtcagacgcccgaccggcggg
agaggtgtgctgcacgatcaggaactgacatacagcgtaattgtttcggaagagcacccc
gagatgccggcgactgttactgaggcttaccgggttatttcagaaggcatacttcaaggc
tttagaaatctcggtctggacgcttactttgccatcccgagaactgaaaaagaaaaagaa
agcttaaaaaatccgcggtcatctgtttgttttgacgcgccttcgtggtatgaactagtg
gttgaggggcgcaaggtggcgggaagcgcgcaaacgagacaaaaaggtgtgattcttcag
catggctccattcttcttgatttagatgaggacaagctgttcgatctgttcttatatcca
agtgaaagagtaagagagcggatgcagcgcaatttcaaaaataaagcggttgccattaat
gaactcatcgaaaagcgggtgacgatggatgaggctcgtaaagcctttaaagaaggattt
gaaacaggtcttaacattcatttggagccatatgaactttctcaggaagagcttgatttt
gttcatcacttggctgaaacaaagtacgcttcagatgaatggaattataagcggtaa

DBGET integrated database retrieval system