KEGG   Bacillus subtilis subsp. subtilis 168: BSU24790
Entry
BSU24790          CDS       T00010                                 

Symbol
yqgX
Name
(RefSeq) hypothetical protein
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU24790 (yqgX)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     BSU24790 (yqgX)
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2 ODP Lactamase_B_3 Lactamase_B_6
Other DBs
NCBI-GeneID: 938218
NCBI-ProteinID: NP_390359
Pasteur: BG11691
BSORF: BG11691
UniProt: P54501 A0A6M3ZDW5
Position
complement(2564923..2565558)
AA seq 211 aa
MKWRRMPVGPIQANAYFLISDDQCLIFDPGGEGHKINQYIKEKGLTPLAILLTHAHFDHI
GALDEVREKWDIPVYLHQNEKNWLADASLNGSGMLRGIEVTAKPADHLIEGDGELNIGPF
HLETLFTPGHSPGSVSYYVKDADLVISGDVLFQGGIGRTDLIGGNQETLLTSIHEKLLTL
PEHTLVLSGHGPETDVLTEQDQNPFLNGFSL
NT seq 636 nt   +upstreamnt  +downstreamnt
gtgaaatggagacgaatgccagtagggccgattcaagcgaacgcatattttctcatcagt
gatgatcaatgtctgatttttgatccgggcggcgagggacataaaatcaatcaatacata
aaagaaaaagggctgacgcctttagccattttgcttacacatgcccattttgaccatatt
ggggcgcttgatgaagtgagagaaaaatgggatatccctgtttacctgcatcaaaatgaa
aaaaattggcttgcggacgcttctttaaacggctccggcatgctgcgagggatagaagtc
acagctaagcctgcagatcatctaattgaaggcgacggtgagttgaatatcgggccgttt
catttggaaacattatttacgccgggacattcaccaggcagtgtgtcttactacgtgaaa
gatgcagacttggtcatttccggagatgtcttgttccaaggcggtataggacgtacggat
ttaataggcggcaatcaagagacgctgctgacgtccattcatgaaaaactgcttacgctt
ccggaacacacgctggtgttaagcggccatggacctgaaacagacgtactgactgagcag
gatcaaaatccgtttttaaatgggttttcattgtaa

DBGET integrated database retrieval system