KEGG   Bacillus subtilis subsp. subtilis 168: BSU24970
Entry
BSU24970          CDS       T00010                                 

Symbol
pstA
Name
(RefSeq) ABC transporter permease
  KO
K02038  phosphate transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU24970 (pstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU24970 (pstA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    BSU24970 (pstA)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 938200
NCBI-ProteinID: NP_390376
Pasteur: BG11377
BSORF: BG11377
UniProt: P46340 A0A6M3ZE53
Position
complement(2578833..2579717)
AA seq 294 aa
MNRKITDKLATGMFGLCAAIIAAILVGLFSYIIINGVSQLSFQFITTKSSAIAAGGGIRD
QLFNSFYILFITMLITIPLGVGGGVFMAEYAPNNKVTDFIRTCIEVLSSLPSIVIGMFGL
LMFVNLTGWGYTIIGGALALTVFNLPVMVRVTEDAIRSVPKDLKEASLALGVSRWHTVKT
VLIPSAIPSIITGAILASGRVFGEAAALLFTAGLTTPRLNFTEWNPFSETSPLNIFRPAE
TLAVHIWNVNTQGMIPDAEAIANGGSAVLVISVLVFNLAARWLGTMIYKKLTAN
NT seq 885 nt   +upstreamnt  +downstreamnt
atgaaccgcaaaataacagataaactggcgaccggaatgtttggtttgtgtgcagccatt
atcgctgccattttagtaggtttgttttcctatattattataaacggtgtttctcagctc
agttttcaatttattacaacaaagtcgagcgccattgcagctggaggaggcatacgagat
cagctgtttaactccttttatattttgtttattacaatgctgattacaatcccgctcggt
gtgggcggcggagtcttcatggctgaatacgcgcctaataacaaagtaactgacttcatt
agaacatgtatagaggtgctttcatctcttccgtctattgtcattgggatgtttggatta
ttgatgtttgtcaacttaacaggctggggttatacgatcataggcggagcgcttgcgtta
actgtttttaaccttcctgtcatggtgcgtgtgacagaagacgcgatccgttcagtccct
aaagatctgaaggaagcctctctcgctttaggtgtatcacgctggcataccgtaaaaaca
gttttaattccaagtgcgattccttctatcatcacaggagcaattttagcgtcaggaagg
gtgttcggggaagcggccgcattattatttacggcaggcctgacaacaccgcgtcttaat
tttacggagtggaacccgttttcggaaacatcaccgcttaatattttcaggcccgctgaa
acacttgcggtccacatttggaacgtcaatacacaaggaatgattccggatgctgaagcg
attgccaacggtggttctgccgtgctggtgatttctgttcttgtgtttaatctcgcggcg
agatggcttggcacgatgatctacaaaaagcttacggcaaattag

DBGET integrated database retrieval system