KEGG   Bacillus subtilis subsp. subtilis 168: BSU25200
Entry
BSU25200          CDS       T00010                                 

Symbol
sigA
Name
(RefSeq) RNA polymerase sigma factor RpoD
  KO
K03086  RNA polymerase primary sigma factor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU25200 (sigA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU25200 (sigA)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU25200 (sigA)
SSDB
Motif
Pfam: Sigma70_r3 Sigma70_r4 Sigma70_r2 Sigma70_r1_1 Sigma70_r1_2 Exonuc_VII_L DUF2316
Other DBs
NCBI-GeneID: 937897
NCBI-ProteinID: NP_390399
Pasteur: BG10314
BSORF: BG10314
UniProt: P06224 A0A6M4JLH7
Structure
PDB: 
5MWW

Position
complement(2600214..2601329)
AA seq 371 aa
MADKQTHETELTFDQVKEQLTESGKKRGVLTYEEIAERMSSFEIESDQMDEYYEFLGEQG
VELISENEETEDPNIQQLAKAEEEFDLNDLSVPPGVKINDPVRMYLKEIGRVNLLSAKEE
IAYAQKIEEGDEESKRRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNMGLMKAVEKFDY
RKGYKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGREPTPE
EIAEDMDLTPEKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDQEATSPSDHAAYELLK
EQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHP
SRSKRLKDFLE
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggctgataaacaaacccacgagacagaattaacattcgaccaagtaaaagagcaatta
acagagtctggtaaaaaacgtggcgttttgacatatgaagaaattgctgagcgtatgtcc
agctttgaaattgaatcagaccaaatggatgagtattatgaatttttaggtgaacaaggt
gttgaattaattagtgagaatgaagaaacagaagatcctaatattcagcagcttgccaaa
gccgaagaagaatttgaccttaatgacctaagtgtaccgcctggcgttaaaatcaatgac
ccagttcgtatgtatttaaaggaaatcggtcgggttaaccttctttctgcaaaagaagaa
atcgcctacgctcaaaagattgaagaaggtgacgaagaatctaaacgcagattggctgaa
gcgaacctgcggcttgttgtcagtatcgcaaaacggtatgtcggacgcggtatgctgttc
cttgatctgatccaggaaggaaacatgggcctgatgaaagccgttgaaaaatttgattat
cgcaaaggttataaattcagtacgtatgctacgtggtggatcagacaggcgattacacgc
gccattgccgatcaggcgagaacgatccggattcccgttcatatggttgaaaccattaat
aaattaatccgtgtgcagcgtcaattactgcaagacttaggcagagaaccaacacctgaa
gaaattgcggaagatatggatttaacgcctgaaaaagtacgcgaaatcttaaagattgct
caagagccggtatctctggaaacaccgatcggtgaagaggatgactcgcaccttggtgat
ttcattgaagaccaagaagcaacttcaccttctgaccacgccgcatacgagctattgaaa
gagcagctggaagatgtgcttgatacgttaactgatcgtgaagaaaatgtattgcgtctt
cgattcggtcttgatgacggccgtacaagaacattagaagaggtcggcaaagtatttgga
gtaacgagagagcgtattcgacaaatcgaagccaaagcgttgcggaaactaagacatcct
agcagaagtaaacgtttgaaagatttccttgaataa

DBGET integrated database retrieval system