KEGG   Bacillus subtilis subsp. subtilis 168: BSU25260
Entry
BSU25260          CDS       T00010                                 

Symbol
glyS
Name
(RefSeq) glycine--tRNA ligase beta subunit
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU25260 (glyS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU25260 (glyS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU25260 (glyS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     BSU25260 (glyS)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   BSU25260 (glyS)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU25260 (glyS)
SSDB
Motif
Pfam: tRNA_synt_2f DALR_1
Other DBs
NCBI-GeneID: 937887
NCBI-ProteinID: NP_390404
Pasteur: BG11658
BSORF: BG11658
UniProt: P54381 A0A6M4JNG5
Position
complement(2605730..2607769)
AA seq 679 aa
MSKQDLLLEIGLEEMPARFLNESMVQLGDKLTGWLKEKNITHGEVKLFNTPRRLAVFVKD
VAEKQDDIKEEAKGPAKKIALDADGNWTKAAIGFSKGQGANVEDLYIKEVKGIEYVFVQK
FQAGQETKSLLPELSGLITSLHFPKNMRWGNEDLRYIRPIKWIVALFGQDVIPFSITNVE
SGRTTQGHRFLGHEVSIESPSAYEEQLKGQHVIADPSVRKQMIQSQLETMAAENNWSIPV
DEDLLDEVNHLVEYPTALYGSFESEFLSIPEEVLVTTMKEHQRYFPVKDKNGDLLPHFIT
VRNGNSHAIENVARGNEKVLRARLSDASFFYKEDQKLNIDANVKKLENIVFHEELGSLAD
KVRRVTSIAEKLAVRLQADEDTLKHVKRAAEISKFDLVTHMIYEFPELQGIMGEKYARML
GEDEAVAAAVNEHYMPRSAGGETPSTFTGAVVAMADKLDTIASFFSIGVIPTGSQDPYGL
RRQASGIVAILLDRNWGISFEELLTFVQTDKENELLDFFTQRLKYVLNAEQIRHDVIDAV
LESSELEPYSALHKAQVLEQKLGAPGFKETAEALGRVISISKKGVRGDIQPDLFENEYEA
KLFDAYQTAKQNLQENFSKKDYEAALASLAALKEPIDAYFDHTMVIADNESLKANRLAQM
VSLADEIKSFANMNALIVK
NT seq 2040 nt   +upstreamnt  +downstreamnt
atgagtaaacaggatttacttttagagatcggattagaggaaatgccggcgcgctttttg
aatgaaagcatggttcagcttggcgacaagctgacaggctggcttaaagaaaaaaatatt
actcacggtgaagtgaaactcttcaatacaccgagacgtcttgctgtgttcgttaaggat
gtcgcagaaaagcaggatgatataaaagaagaagcaaaagggcctgcgaaaaaaattgcc
cttgatgcggacgggaactggacaaaagcggcaatcggcttttcaaaaggccaaggcgca
aatgtggaagacctgtacatcaaagaagtaaaaggcatagagtatgtattcgtgcaaaaa
ttccaagccggccaagaaacgaagtcgcttctgccagaattgagcggtttaattacaagc
ttgcatttcccgaaaaacatgcgctggggaaatgaagatttgcgttatatccgaccgatc
aaatggattgtcgcattatttggacaggatgtcattccattttcgatcacaaacgttgag
tctggacggacaacacagggacaccgtttcctcggacatgaagtgtcaattgaatcacct
tcagcttatgaagagcagctcaaaggacagcatgttattgctgatcctagcgtccgaaag
caaatgattcaatctcagctggaaacaatggctgctgaaaacaattggagcattccagtt
gacgaagaccttcttgatgaagtgaatcatttagtagaatacccgacagctctttacggt
tcatttgaatccgagtttctgtcaattcctgaagaagtgcttgtcacgacaatgaaagag
catcagcgctacttccctgtcaaagacaaaaacggtgacctgctgcctcactttatcaca
gtccgaaacggcaacagccacgcgattgaaaatgtggcccgaggcaatgaaaaagtgctg
cgcgcacgtttatctgatgcttcattcttctacaaagaagatcagaaactaaacattgat
gcaaatgtgaagaagcttgaaaatatcgttttccatgaagagcttggttctcttgctgat
aaggttaggagagtcacatcaatcgcagagaaacttgccgttcgtcttcaggctgatgaa
gatacattaaaacatgtgaagcgggctgctgaaatttctaaattcgaccttgtgacgcat
atgatatatgaattccctgaacttcaaggaattatgggcgaaaagtatgcgagaatgctt
ggcgaagatgaagctgtggctgcggcagttaatgaacattatatgcctagatcagcgggc
ggagaaacgccttctactttcaccggagctgttgtagcaatggcggataagcttgacaca
atcgcttcattcttctctatcggcgtaattccgaccggttcccaggacccttacggactg
cgccgccaagcaagcggtattgttgcgattcttcttgaccgcaactggggaatttcattt
gaagagctgcttactttcgttcaaaccgataaagaaaatgaactgctggatttcttcact
cagcgcttgaaatatgtcttgaatgctgaacaaatcagacatgatgtcattgacgccgtg
ctggaaagctctgagcttgagccgtactctgcgctgcataaagcacaagtactggagcaa
aagcttggtgcacctggctttaaggaaacagccgaagcgttaggccgagtgatctctatc
agcaaaaaaggagtccgcggagacattcagcctgatctgtttgaaaatgaatacgaagca
aaactgtttgatgcctaccaaacagcgaagcaaaatctgcaggaaaacttcagcaaaaaa
gattatgaggcggcgcttgcttcacttgcagccttaaaagaaccgatcgatgcttacttc
gatcatacaatggttatagcggataatgagtcattaaaggcaaatcgtttagcgcaaatg
gtaagcttggcggatgagatcaagtcctttgcgaatatgaatgcccttattgtaaaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU25270
Entry
BSU25270          CDS       T00010                                 

Symbol
glyQ
Name
(RefSeq) glycine--tRNA ligase alpha subunit
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU25270 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU25270 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU25270 (glyQ)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     BSU25270 (glyQ)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   BSU25270 (glyQ)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU25270 (glyQ)
SSDB
Motif
Pfam: tRNA-synt_2e
Other DBs
NCBI-GeneID: 937888
NCBI-ProteinID: NP_390405
Pasteur: BG11657
BSORF: BG11657
UniProt: P54380 A0A6M3ZEJ6
Position
complement(2607762..2608649)
AA seq 295 aa
MNIQDMILTLQKHWSSQGCVLMQAYDVEKGAGTMSPYTFLRSIGPEPWKVAYVEPSRRPA
DGRYGENPNRLYQHHQFQVIIKPSPDNIQELYLDSLRALGIDPLEHDIRFVEDNWENPSL
GCAGLGWEVWLDGMEITQFTYFQQVGGLECKPVSVEITYGIERLASYIQDKENVFDLEWT
SGFTVKDLFMMAEYEHSVYTFETSDVDMLFQLFSTYEKEAIKQMDNGLVHPAYDYVLKCS
HTFNLLDAKGAISVTERTGYIARVRNLARKVAKTYYEEREKLGFPMLKGEGSSHE
NT seq 888 nt   +upstreamnt  +downstreamnt
atgaatattcaagacatgattctaaccttgcaaaagcattggtccagtcagggctgtgtg
cttatgcaggcttacgatgtagaaaaaggagccggcacgatgagcccgtatacatttttg
cgcagtatcggtcctgagccgtggaaagtggcttatgtagagccttccagacgtccggca
gacggccgctacggggagaacccgaacagactgtatcagcatcatcagttccaggtcatt
attaaaccgtcacctgataacattcaagagctgtatttggattccttgcgtgctcttgga
attgatccgcttgagcacgatattcgctttgttgaagacaactgggagaatccgtcttta
ggctgcgcgggtctaggctgggaagtttggcttgacggaatggaaataacacaatttacg
tatttccagcaggtcgggggattagagtgtaaacccgtttctgtagagattacgtatgga
attgagcgtctcgcgtcttatatccaggataaagaaaacgtgtttgacttggaatggacg
tcagggtttacagtaaaagatttattcatgatggctgaatatgagcattctgtttatacg
tttgaaacatcagacgtcgatatgctgttccaattgttcagcacatatgaaaaagaagcg
atcaagcaaatggacaacggacttgttcatccagcatatgactatgtgctgaaatgctcg
cacactttcaacctgcttgatgccaaaggtgcgatctctgttaccgagcggacgggctat
atcgcaagagtgcggaatttagctagaaaagtagcaaaaacctactatgaggaacgagaa
aaactagggttcccaatgcttaaaggggagggttcttctcatgagtaa

DBGET integrated database retrieval system