KEGG   Bacillus subtilis subsp. subtilis 168: BSU25280
Entry
BSU25280          CDS       T00010                                 

Symbol
recO
Name
(RefSeq) DNA repair protein RecO
  KO
K03584  DNA repair protein RecO (recombination protein O)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BSU25280 (recO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU25280 (recO)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BSU25280 (recO)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BSU25280 (recO)
SSDB
Motif
Pfam: RecO_C RecO_N RecO_N_2 DUF4428 DZR_2 Polyoma_agno
Other DBs
NCBI-GeneID: 937881
NCBI-ProteinID: NP_390406
Pasteur: BG11189
BSORF: BG11189
UniProt: P42095 A0A6M4JJ76
Position
complement(2608946..2609713)
AA seq 255 aa
MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGAKKPNSRLSAVSQPFLYGSFLM
QKTSGLGTLQQGEMILSMRGIREDLFLTAYAAYVAELVDRGTEEKKPNPYLFEFILESLK
QLNEGTDPDVITFIVQMKMLGVMGLYPELNHCVHCKSQDGTFHFSVRDNGFICHRCFEKD
PYRIPIKPQTARLLRLFYYFDLSRLGNVSLKEETKAELKQVIDLYYEEYSGLYLKSKRFL
DQMESMKHLMGENKS
NT seq 768 nt   +upstreamnt  +downstreamnt
atgctgacaaaatgtgaagggatcgttcttcgcacaaatgattacggagagacgaataaa
atcgtaacattactgacaagagaacacggaaaaataggtgttatggcacgaggcgccaaa
aaaccgaacagccgtttatcagcagtcagccagccctttttgtatggttctttcttaatg
caaaaaacatcgggcctcggaacgcttcagcagggggaaatgatcctcagcatgagaggc
atcagggaagacttgtttttaacagcatatgctgcctatgttgctgagttagtcgacaga
ggcacagaagaaaaaaagccaaatccttatttatttgaattcatattagaatcattaaaa
cagttgaatgaaggaacagatccggatgttatcaccttcattgttcaaatgaagatgctc
ggtgtcatgggcctgtatcctgagctgaatcattgtgtacattgtaaaagccaagacgga
acctttcatttctctgttcgtgataatggttttatatgccaccgctgttttgaaaaagat
ccttacaggataccgattaaaccgcaaacggcaaggctgttaaggctcttttactatttt
gatctgtcgagactcggcaatgtgtccttaaaagaggaaacaaaagctgaattaaagcaa
gtgattgatttatattacgaagaatattcgggattgtatttaaaatcaaagcgcttttta
gatcaaatggaaagcatgaaacatcttatgggtgaaaacaaaagttga

DBGET integrated database retrieval system