KEGG   Bacillus subtilis subsp. subtilis 168: BSU25410
Entry
BSU25410          CDS       T00010                                 

Symbol
rpsU
Name
(RefSeq) 30S ribosomal protein S21
  KO
K02970  small subunit ribosomal protein S21
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU25410 (rpsU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU25410 (rpsU)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU25410 (rpsU)
  Bacteria
    BSU25410 (rpsU)
SSDB
Motif
Pfam: Ribosomal_S21 CBS
Other DBs
NCBI-GeneID: 937861
NCBI-ProteinID: NP_390419
Pasteur: BG11648
BSORF: BG11648
UniProt: P21478 A0A6M4JKW8
Position
complement(2620371..2620544)
AA seq 57 aa
MSKTVVRKNESLEDALRRFKRSVSKTGTLQEARKREFYEKPSVKRKKKSEAARKRKF
NT seq 174 nt   +upstreamnt  +downstreamnt
atgtcaaaaacggtcgttagaaaaaacgaatcgcttgaagatgctcttcgtcgcttcaaa
cgcagtgtatcaaagacaggtactttgcaagaagcaagaaagcgtgaattttatgaaaaa
cctagcgtaaagcgcaagaaaaagtctgaagctgctagaaaacgcaaattctaa

DBGET integrated database retrieval system