KEGG   Bacillus subtilis subsp. subtilis 168: BSU25470
Entry
BSU25470          CDS       T00010                                 

Symbol
dnaK
Name
(RefSeq) chaperone protein DnaK
  KO
K04043  molecular chaperone DnaK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU25470 (dnaK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU25470 (dnaK)
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU25470 (dnaK)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU25470 (dnaK)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU25470 (dnaK)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     BSU25470 (dnaK)
Chaperones and folding catalysts [BR:bsu03110]
 Heat shock proteins
  HSP70 / DNAK
   BSU25470 (dnaK)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    BSU25470 (dnaK)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    BSU25470 (dnaK)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BSU25470 (dnaK)
  Exosomal proteins of breast cancer cells
   BSU25470 (dnaK)
  Exosomal proteins of colorectal cancer cells
   BSU25470 (dnaK)
SSDB
Motif
Pfam: HSP70 MreB_Mbl DMRL_synthase FGGY_C
Other DBs
NCBI-GeneID: 937849
NCBI-ProteinID: NP_390425
Pasteur: BG10664
BSORF: BG10664
UniProt: P17820 A0A6M4JJA3
Structure
Position
complement(2626112..2627947)
AA seq 611 aa
MSKVIGIDLGTTNSCVAVLEGGEPKVIANAEGNRTTPSVVAFKNGERQVGEVAKRQSITN
PNTIMSIKRHMGTDYKVEIEGKDYTPQEVSAIILQHLKSYAESYLGETVSKAVITVPAYF
NDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKTDEDQTILVYDLGGGTFDVSILE
LGDGVFEVRSTAGDNRLGGDDFDQVIIDHLVSEFKKENGIDLSKDKMALQRLKDAAEKAK
KDLSGVSSTQISLPFITAGEAGPLHLELTLTRAKFEELSSHLVERTMGPVRQALQDAGLS
ASEIDKVILVGGSTRIPAVQEAIKKETGKEAHKGVNPDEVVALGAAIQGGVITGDVKDVV
LLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTAADNQTAVDIHVLQGERPMSAD
NKTLGRFQLTDIPPAPRGVPQIEVSFDIDKNGIVNVRAKDLGTGKEQNITIKSSSGLSDE
EIERMVKEAEENADADAKKKEEIEVRNEADQLVFQTEKTLKDLEGKVDEEQVKKANDAKD
ALKAAIEKNEFEEIKAKKDELQTIVQELSMKLYEEAAKAQQAQGGANAEGKADDNVVDAE
YEEVNDDQNKK
NT seq 1836 nt   +upstreamnt  +downstreamnt
gtgagtaaagttatcggaatcgacttaggaacaacaaactcatgtgtggcagtgcttgaa
ggcggcgagcctaaagttattgctaacgctgaaggaaaccgcacaacgccatcagttgtt
gcatttaaaaacggcgaacgtcaagtaggggaagtggctaaacgccaatctattacaaac
cctaacacaattatgtctatcaaacgtcatatgggtactgattataaagttgaaattgaa
ggaaaggattacactccacaagaagtgtctgctatcatccttcaacaccttaaatcatac
gctgaaagctatcttggcgaaacagtatcaaaagcagttatcacagttcctgcatacttt
aacgatgctgagcgtcaagcaacaaaagacgctggtaaaattgcaggtcttgaagtagaa
cgtatcatcaacgagccgactgcagcagcgcttgcatacggacttgataaaacagatgaa
gatcaaacgatcctagtatacgaccttggcggcggtacattcgacgtttccatccttgag
cttggcgacggtgtattcgaagttcgttcaactgccggcgacaaccgtctgggtggggac
gattttgaccaagttatcatcgatcatctggtgtctgaattcaaaaaagaaaacggcatt
gatttgtcaaaagacaaaatggcgcttcagcgtttgaaagacgcagctgaaaaagcgaaa
aaagatctttccggcgtatcttctacgcaaatttctttaccgtttatcacagctggagaa
gcaggaccgcttcaccttgaacttacattaactcgcgctaaattcgaagagctttcttct
catttagtagagcgcacaatgggtcctgtccgtcaagcgcttcaagatgcaggactttct
gcaagcgaaatcgacaaagtcatccttgtcggcggatcaactcgtatccctgccgtacaa
gaagcaatcaaaaaagaaactggaaaagaagcgcataaaggcgtaaacccggatgaagtt
gtagcgcttggtgctgcgattcagggcggcgttatcacaggtgacgtaaaagatgttgtt
cttcttgacgttacaccgctttctctcggtatcgaaacaatgggcggtgtgtttacaaaa
ctgatcgaccgcaacacgacgatcccaacaagcaaatctcaagtgttctcaactgctgct
gataaccaaacagctgttgatatccatgttcttcaaggtgagcgcccaatgtctgccgac
aacaaaacactcggccgcttccagcttactgatatcccgccagcaccgcgcggcgtgcct
caaatcgaagtttctttcgatattgacaaaaacggtatcgtaaacgtaagagcaaaagac
ttaggcacaggaaaagaacaaaacattacaatcaaatcttcttcaggtctctcagatgaa
gagatcgaacgcatggtaaaagaagcggaagaaaatgctgacgctgatgcgaagaaaaaa
gaagaaatcgaagtccgcaacgaagcagatcagcttgttttccaaactgagaaaacatta
aaagatcttgaaggcaaagtggacgaagaacaagtgaaaaaagccaacgatgccaaagac
gctttaaaagcagcgattgagaaaaacgaatttgaagagatcaaagcgaaaaaagatgag
cttcaaacaatcgttcaagagctttctatgaagctttatgaagaagctgctaaagcacag
caagctcaaggcggagcaaacgctgaaggcaaagcggatgacaacgttgtcgacgctgaa
tacgaagaagtaaacgacgaccaaaacaaaaaataa

DBGET integrated database retrieval system