KEGG   Bacillus subtilis subsp. subtilis 168: BSU26800
Entry
BSU26800          CDS       T00010                                 

Symbol
yrpB
Name
(RefSeq) nitronate monooxygenase
  KO
K00459  nitronate monooxygenase [EC:1.13.12.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00910  Nitrogen metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSU26800 (yrpB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.16  nitronate monooxygenase
     BSU26800 (yrpB)
SSDB
Motif
Pfam: NMO IMPDH NanE FMN_dh His_biosynth DUF561 TMP-TENI
Other DBs
NCBI-GeneID: 936455
NCBI-ProteinID: NP_390557
Pasteur: BG12305
BSORF: BG12305
UniProt: O05413 A0A6M3ZEG6
Position
2736915..2737958
AA seq 347 aa
MNEFMKKFSLTKPIIQAPMAGGITKPRLASAVSNQGALGSLASGYLTPDLLEQQIKEIFE
LTDAPFQINVFVPLGLEMPPKDQIKKWKENIPLANQVNQFTSVQEEWDDFYQKIDLILKY
KVKACSFTFDLPPEDAVKELKTAGCCLIGTASTVEEALLMEERGMDIVVLQGSEAGGHRG
AFLPSKGESAVGLMALIPQAADALSVPVIAAGGMIDHRGVKAALTLGAQGVQIGSAFLIC
HESNAHPVHKQKILEANEADTKLTTLFSGKEARGIVNKWMEENEQFETQTLPYPYQNTLT
KAMRQKASLQNNHDQMSLWAGQGIRSLTEEISVKQLLNQLCQEDIKI
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaatgaatttatgaaaaagttttctttaacaaaaccgattattcaagctccaatggct
ggcggtattacaaagccccgacttgcatctgcagtttcgaatcaaggtgctcttggcagc
ttagcatcggggtatcttacgccagacctcctagaacaacaaataaaagaaatatttgag
ctgacagacgctccttttcaaattaatgtgtttgttccgctaggtctagagatgccacca
aaagatcagattaaaaagtggaaagaaaacataccgttagctaatcaagtaaatcaattc
acatctgtacaagaagagtgggatgacttctatcaaaaaattgatctaattttaaaatac
aaggttaaggcttgctcattcacttttgatctgccgcctgaagacgcagtaaaggagcta
aaaaccgctggatgctgtttaataggaaccgcttcaacagtagaagaagcattgttaatg
gaagaacggggaatggatatagtagtccttcaaggaagtgaagccggtggacatcgcgga
gcattcttaccttccaaaggtgaatctgccgtaggtttaatggctctgattccacaagca
gcagatgcactgagcgtacctgtcatagctgctgggggaatgatagaccacagaggagta
aaagcagctttaaccctcggagcccaaggcgttcaaatcggttctgcctttttaatttgt
cacgagagtaacgcacatccagtgcataaacagaaaatactagaagcaaacgaagcagat
acaaagcttacgacattattttcaggtaaagaggccagaggaatcgtaaataaatggatg
gaagaaaatgaacagtttgagacacaaacccttccgtacccttatcaaaatacactaacg
aaggcaatgagacagaaggcttcacttcaaaataaccatgatcagatgtctttatgggca
ggtcaagggatacggtcattgactgaggaaatttcggttaagcagcttttaaatcagctt
tgccaagaggatataaaaatatag

DBGET integrated database retrieval system