KEGG   Bacillus subtilis subsp. subtilis 168: BSU27410
Entry
BSU27410          CDS       T00010                                 

Symbol
alaS
Name
(RefSeq) alanine--tRNA ligase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU27410 (alaS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU27410 (alaS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU27410 (alaS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     BSU27410 (alaS)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   BSU27410 (alaS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU27410 (alaS)
 Prokaryotic type
    BSU27410 (alaS)
SSDB
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD Hrs_helical T4_Rnl2_C EzrA KELK KASH_CCD ATG17_like ATG14 DUF4201 Seryl_tRNA_N YjcZ She9_MDM33 Fez1
Other DBs
NCBI-GeneID: 939643
NCBI-ProteinID: NP_390618
Pasteur: BG12563
BSORF: BG12563
UniProt: O34526 A0A6M4JMA0
Position
complement(2798174..2800810)
AA seq 878 aa
MKHLTSAEVRQMFLDFFKEKGHAVEPSASLVPHEDPSLLWINSGVATLKKYFDGRVVPEN
PRIVNAQKAIRTNDIENVGKTARHHTFFEMLGNFSIGDYFKEEAITWAWEFLTSDKWIGF
DKELLSVTVHPEDEEAYEFWAKKIGIPEERIIRLEGNFWDIGEGPSGPNTEIFYDRGEAY
GNDPEDPELYPGGENDRYLEVWNLVFSEFNHNPDGTYTPLPKKNIDTGMGLERMVSVIQN
VPTNFDTDLFVPIIKATESISGETYGKDNVKDTAFKVIADHIRTVAFAVSDGALPSNEGR
GYVLRRLLRRAVRYAKTINIHRPFMFDLVPVVAEIMADFYPEVKEKADFIAKVIKTEEER
FHETLNEGLAILSEMIKKEKDKGSSVISGADVFKLYDTYGFPVELTEEYAEDENMTVDHE
GFEEEMNQQRERARNARQDVGSMQVQGGALRDVTVESTFVGYSQTKADANIIVLLQDGQL
IEEAHEGESVQIILDETPFYAESGGQIGDKGYLRSEQAVVRIKDVQKAPNGQHVHEGVVE
SGTVQKGLHVTAEVEDHMRSGVIKNHTATHLLHQALKDVLGTHVNQAGSLVTENRLRFDF
SHFGQVTKEELEQIERIVNEKIWASIPVSIDLKPIAEAKEMGAMALFGEKYGDIVRVVQV
GDYSLELCGGCHVRNTAEIGLFKIVSESGIGAGTRRIEAVTGQGAYVEMNSQISVLKQTA
DELKTNIKEVPKRVAALQAELKDAQRENESLLAKLGNVEAGAILSKVKEVDGVNVLAAKV
NAKDMNHLRTMVDELKAKLGSAVIVLGAVQNDKVNISAGVTKDLIEKGLHAGKLVKQAAE
VCGGGGGGRPDMAQAGGKQPEKLEEALASVEDWVKSVL
NT seq 2637 nt   +upstreamnt  +downstreamnt
atgaaacacttaacttctgcggaagtgcgtcaaatgtttttggatttctttaaagaaaaa
ggacatgcggtagagccaagcgcgtcattagtgcctcatgaggatccttcactgctttgg
atcaacagcggtgttgcgacgctgaaaaaatattttgacggccgtgtcgtgccggaaaat
ccaagaatcgtaaacgctcaaaaagcgatcagaacaaacgatatagaaaatgtaggtaaa
actgcgcgccatcacactttctttgaaatgctcggaaacttttccatcggcgattatttc
aaagaagaagccattacatgggcttgggagtttttaacgagcgacaagtggattggcttc
gacaaagagcttctctctgttacggttcatcctgaagatgaagaggcatatgagttttgg
gcgaaaaaaatcggtattcctgaagaaagaattatccgtctggaagggaacttctgggat
atcggtgaagggccgagcggaccgaatacggaaatcttttacgaccgcggtgaagcatac
ggtaatgatccagaagatccggagctttacccaggcggggaaaacgaccgttacctggaa
gtatggaaccttgtgttctcagagttcaaccataaccctgacggcacgtacacaccgctt
ccaaagaaaaatattgatacaggcatgggtcttgaaagaatggtgtctgtcatccagaat
gttccgacaaactttgacaccgatttgtttgttccgatcattaaagcaacagaatcgatt
tctggtgaaacatatggcaaagacaatgtgaaagacactgcgtttaaagtgattgctgac
catatcagaacggttgcctttgctgtcagtgacggtgcgctgccgtcaaatgaaggccgc
ggctatgtattaagacgcttattacgccgtgccgtgcgttatgccaaaacgatcaacatc
catcgtccgttcatgtttgatttagtgccggttgtcgcagaaatcatggctgatttctat
cctgaagtgaaagagaaagcggatttcatcgcaaaagtcattaaaaccgaggaagaacgc
ttccatgagacccttaatgaagggcttgcgatcctgtcagaaatgatcaaaaaagaaaaa
gacaagggcagcagcgttatctcaggtgctgatgtgtttaaactgtatgatacgtatgga
ttcccggttgaattgactgaagaatacgcagaagacgagaacatgacggttgaccatgag
ggctttgaggaggaaatgaaccagcagcgtgaacgggcaagaaacgcccgccaggatgtc
ggcagcatgcaggtgcagggcggcgcactgcgcgacgtgacagttgaaagcacatttgtc
ggctactctcaaaccaaagctgatgccaatatcattgtgcttcttcaggacggccaatta
atcgaagaggctcatgaaggagaaagcgttcaaatcattcttgatgaaacaccgttctat
gcagaaagcggcggccaaatcggcgacaaaggctatctccgaagcgagcaggcagttgta
agaattaaagatgttcaaaaagcgccgaacggccagcatgtgcatgaaggtgttgtggag
agcggtactgttcaaaaaggcctgcatgttacggctgaagttgaagaccatatgagaagc
ggcgtcattaaaaaccacacggcaacgcatttattgcatcaggctctaaaagatgttctt
ggaactcatgtcaatcaggcgggctctcttgtaacggaaaaccgccttcgttttgacttc
tcgcactttggccaagtgacaaaagaagagctcgaacaaattgaaagaatcgtaaacgaa
aagatctgggcgagcatcccggtcagcattgatttgaaaccgatcgctgaagcaaaagaa
atgggtgcgatggcactgttcggcgaaaaatatggcgatattgtccgtgtcgttcaagtt
ggagattacagcttagagctgtgcggcggctgccacgtcagaaatacagcagaaatcggc
ttgtttaaaatcgtttctgaatccggaatcggagcaggcacaagacggattgaagctgta
acgggacaaggcgcttacgtcgaaatgaacagccagatttctgtattgaagcagaccgct
gacgagctgaaaacaaatatcaaagaagtgccgaaacgggtcgcggctctgcaggctgaa
ctgaaggatgcacaaagagaaaatgaatctcttcttgcaaaactaggcaacgtggaagca
ggagcaatcctgtcgaaagtaaaagaagttgacggcgtaaacgtgcttgcggcaaaagta
aatgcaaaagacatgaatcatctccgcactatggtcgatgaactcaaagcaaagcttggc
tctgcggtgatcgtgcttggtgcggtacaaaacgataaagttaatatctctgccggagtc
acaaaggacctcattgagaaaggacttcacgccggcaagctggttaaacaagctgcggaa
gtttgcggcggaggcggcggaggccgtccggacatggcgcaggcaggcggtaaacagccg
gaaaaattagaagaagctttggcttctgtagaagattgggtgaaatccgttttataa

DBGET integrated database retrieval system