KEGG   Bacillus subtilis subsp. subtilis 168: BSU27960
Entry
BSU27960          CDS       T00010                                 

Symbol
rplU
Name
(RefSeq) 50S ribosomal protein L21
  KO
K02888  large subunit ribosomal protein L21
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU27960 (rplU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU27960 (rplU)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU27960 (rplU)
  Bacteria
    BSU27960 (rplU)
SSDB
Motif
Pfam: Ribosomal_L21p P30 HTH_15
Other DBs
NCBI-GeneID: 936368
NCBI-ProteinID: NP_390674
Pasteur: BG10333
BSORF: BG10333
UniProt: P26908 A0A6M4JKM8
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
complement(2855518..2855826)
AA seq 102 aa
MYAIIKTGGKQIKVEEGQTVYIEKLAAEAGETVTFEDVLFVGGDNVKVGNPTVEGATVTA
KVEKQGRAKKITVFRYKPKKNVHKKQGHRQPYTKVTIEKINA
NT seq 309 nt   +upstreamnt  +downstreamnt
atgtacgcaatcattaaaacaggcggtaaacaaatcaaagttgaagaaggccaaactgtt
tacatcgaaaaacttgctgctgaagcaggtgaaacagttacttttgaagacgttttgttt
gttggcggagacaacgtgaaagtcggcaaccctacagttgaaggcgcaacagtaacggct
aaagttgaaaaacaaggccgcgcgaaaaaaatcactgttttcagatacaaaccaaagaaa
aacgttcataaaaaacaaggtcatcgtcagccttacactaaagtgacgatcgaaaaaatc
aacgcgtaa

DBGET integrated database retrieval system