KEGG   Bacillus subtilis subsp. subtilis 168: BSU28300
Entry
BSU28300          CDS       T00010                                 

Symbol
ilvH
Name
(RefSeq) acetolactate synthase small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00290  Valine, leucine and isoleucine biosynthesis
bsu00650  Butanoate metabolism
bsu00660  C5-Branched dibasic acid metabolism
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bsu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU28300 (ilvH)
   00660 C5-Branched dibasic acid metabolism
    BSU28300 (ilvH)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BSU28300 (ilvH)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU28300 (ilvH)
Enzymes [BR:bsu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     BSU28300 (ilvH)
SSDB
Motif
Pfam: ALS_ss_C ACT ACT_5 ACT_4 EIIC-GAT
Other DBs
NCBI-GeneID: 937477
NCBI-ProteinID: NP_390708
Pasteur: BG10671
BSORF: BG10671
UniProt: P37252 A0A6M3ZF39
Position
complement(2894733..2895251)
AA seq 172 aa
MKRIITLTVVNRSGVLNRITGLFTKRHYNIESITVGHTETAGVSRITFVVHVEGENDVEQ
LTKQLNKQIDVLKVTDITNQSIVQRELALIKVVSAPSTRTEINGIIEPFRASVVDVSRDS
IVVQVTGESNKIEALIELLKPYGIKEIARTGTTAFARGTQQKASSNKTISIV
NT seq 519 nt   +upstreamnt  +downstreamnt
ttgaaaagaattatcacattgactgtggtgaaccgctccggggtgttaaaccggatcacc
ggtctattcacaaaaaggcattacaacattgaaagcattacagttggacacacagaaaca
gccggcgtttccagaatcaccttcgtcgttcatgttgaaggtgaaaatgatgttgaacag
ttaacgaaacagctcaacaaacagattgatgtgctgaaagtcacagacatcacaaatcaa
tcgattgtccagagggagctggccttaatcaaggttgtctccgcaccttcaacaagaaca
gagattaatggaatcatagaaccgtttagagcctctgtcgttgatgtcagcagagacagc
atcgttgttcaggtgacaggtgaatctaacaaaattgaagcgcttattgagttattaaaa
ccttatggcattaaagaaatcgcgagaacaggtacaacggcttttgcgaggggaacccag
caaaaggcgtcatccaataaaacaatatctattgtataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU28310
Entry
BSU28310          CDS       T00010                                 

Symbol
ilvB
Name
(RefSeq) acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00290  Valine, leucine and isoleucine biosynthesis
bsu00650  Butanoate metabolism
bsu00660  C5-Branched dibasic acid metabolism
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bsu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU28310 (ilvB)
   00660 C5-Branched dibasic acid metabolism
    BSU28310 (ilvB)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BSU28310 (ilvB)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU28310 (ilvB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     BSU28310 (ilvB)
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_N TPP_enzyme_M DXP_synthase_N CO_dh
Other DBs
NCBI-GeneID: 936792
NCBI-ProteinID: NP_390709
Pasteur: BG10670
BSORF: BG10670
UniProt: P37251 A0A6M3ZJT0
Position
complement(2895248..2896972)
AA seq 574 aa
MGTNVQVDSASAECTQTMSGALMLIESLKKEKVEMIFGYPGGAVLPIYDKLYNSGLVHIL
PRHEQGAIHAAEGYARVSGKPGVVIATSGPGATNLVTGLADAMIDSLPLVVFTGQVATSV
IGSDAFQEADILGITMPVTKHSYQVRQPEDLPRIIKEAFHIATTGRPGPVLIDIPKDVAT
IEGEFSYDHEMNLPGYQPTTEPNYLQIRKLVEAVSSAKKPVILAGAGVLHGKASEELKNY
AEQQQIPVAHTLLGLGGFPADHPLFLGMAGMHGTYTANMALHECDLLISIGARFDDRVTG
NLKHFARNAKIAHIDIDPAEIGKIMKTQIPVVGDSKIVLQELIKQDGKQSDSSEWKKQLA
EWKEEYPLWYVDNEEEGFKPQKLIEYIHQFTKGEAIVATDVGQHQMWSAQFYPFQKADKW
VTSGGLGTMGFGLPAAIGAQLAEKDATVVAVVGDGGFQMTLQELDVIRELNLPVKVVILN
NACLGMVRQWQEIFYEERYSESKFASQPDFVKLSEAYGIKGIRISSEAEAKEKLEEALTS
REPVVIDVRVASEEKVFPMVAPGKGLHEMVGVKP
NT seq 1725 nt   +upstreamnt  +downstreamnt
atggggactaatgtacaggtggattcagcatctgccgaatgtacacagacgatgagcgga
gcattaatgctgattgaatcattaaaaaaagagaaagtagaaatgatcttcggttatccg
ggcggggctgtgcttccgatttacgataagctatacaattcagggttggtacatatcctt
ccccgtcacgaacaaggagcaattcatgcagcggagggatacgcaagggtctccggaaaa
ccgggtgtcgtcattgccacgtcagggccgggagcgacaaaccttgttacaggccttgct
gatgccatgattgattcattgccgttagtcgtctttacagggcaggtagcaacctctgta
atcgggagcgatgcatttcaggaagcagacattttagggattacgatgccagtaacaaaa
cacagctaccaggttcgccagccggaagatctgccgcgcatcattaaagaagcgttccat
attgcaacaactggaagacccggacctgtattgattgatattccgaaagatgtagcaaca
attgaaggagaattcagctacgatcatgagatgaatctcccgggataccagccgacaaca
gagccgaattatttgcagatccgcaagcttgtggaagccgtgagcagtgcgaaaaaaccg
gtgatcctggcgggtgcgggcgtactgcacggaaaagcgtcagaagaattaaaaaattat
gctgaacagcagcaaatccctgtggcacacacccttttggggctcggaggcttcccggct
gaccatccgcttttcctagggatggcgggaatgcacggtacttatacagccaatatggcc
cttcatgaatgtgatctattaatcagtatcggcgcccgttttgatgaccgtgtcacagga
aacctgaaacactttgccagaaacgcaaagatagcccacatcgatattgatccagctgaa
atcggaaaaatcatgaaaacacagattcctgtagtcggagacagcaaaattgtcctgcag
gagctgatcaaacaagacggcaaacaaagcgattcaagcgaatggaaaaaacagctcgca
gaatggaaagaagagtatccgctctggtatgtagataatgaagaagaaggttttaaacct
cagaaattgattgaatatattcatcaatttacaaaaggagaggccattgtcgcaacggat
gtaggccagcatcaaatgtggtcagcgcaattttatccgttccaaaaagcagataaatgg
gtcacgtcaggcggacttggaacgatgggattcggtcttccggcggcgatcggcgcacag
ctggccgaaaaagatgctactgttgtcgcggttgtcggagacggcggattccaaatgacg
cttcaagaactcgatgttattcgcgaattaaatcttccggtcaaggtagtgattttaaat
aacgcttgtctcggaatggtcagacagtggcaggaaattttctatgaagaacgttattca
gaatctaaattcgcttctcagcctgacttcgtcaaattgtccgaagcatacggcattaaa
ggcatcagaatttcatcagaagcggaagcaaaggaaaagctggaagaggcattaacatca
agagaacctgttgtcattgacgtgcgggttgccagcgaagaaaaagtattcccgatggtg
gctccggggaaagggctgcatgaaatggtgggggtgaaaccttga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU36010
Entry
BSU36010          CDS       T00010                                 

Symbol
alsS
Name
(RefSeq) acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00290  Valine, leucine and isoleucine biosynthesis
bsu00650  Butanoate metabolism
bsu00660  C5-Branched dibasic acid metabolism
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bsu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU36010 (alsS)
   00660 C5-Branched dibasic acid metabolism
    BSU36010 (alsS)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BSU36010 (alsS)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU36010 (alsS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     BSU36010 (alsS)
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-GeneID: 936852
NCBI-ProteinID: NP_391482
Pasteur: BG10471
BSORF: BG10471
UniProt: Q04789 A0A6M4JPS5
Structure
PDB: 
4RJJ 4RJK 4RJI

Position
complement(3709628..3711340)
AA seq 570 aa
MTKATKEQKSLVKNRGAELVVDCLVEQGVTHVFGIPGAKIDAVFDALQDKGPEIIVARHE
QNAAFMAQAVGRLTGKPGVVLVTSGPGASNLATGLLTANTEGDPVVALAGNVIRADRLKR
THQSLDNAALFQPITKYSVEVQDVKNIPEAVTNAFRIASAGQAGAAFVSFPQDVVNEVTN
TKNVRAVAAPKLGPAADDAISAAIAKIQTAKLPVVLVGMKGGRPEAIKAVRKLLKKVQLP
FVETYQAAGTLSRDLEDQYFGRIGLFRNQPGDLLLEQADVVLTIGYDPIEYDPKFWNING
DRTIIHLDEIIADIDHAYQPDLELIGDIPSTINHIEHDAVKVEFAEREQKILSDLKQYMH
EGEQVPADWKSDRAHPLEIVKELRNAVDDHVTVTCDIGSHAIWMSRYFRSYEPLTLMISN
GMQTLGVALPWAIGASLVKPGEKVVSVSGDGGFLFSAMELETAVRLKAPIVHIVWNDSTY
DMVAFQQLKKYNRTSAVDFGNIDIVKYAESFGATGLRVESPDQLADVLRQGMNAEGPVII
DVPVDYSDNINLASDKLPKEFGELMKTKAL
NT seq 1713 nt   +upstreamnt  +downstreamnt
ttgacaaaagcaacaaaagaacaaaaatcccttgtgaaaaacagaggggcggagcttgtt
gttgattgcttagtggagcaaggtgtcacacatgtatttggcattccaggtgcaaaaatt
gatgcggtatttgacgctttacaagataaaggacctgaaattatcgttgcccggcacgaa
caaaacgcagcattcatggcccaagcagtcggccgtttaactggaaaaccgggagtcgtg
ttagtcacatcaggaccgggtgcctctaacttggcaacaggcctgctgacagcgaacact
gaaggagaccctgtcgttgcgcttgctggaaacgtgatccgtgcagatcgtttaaaacgg
acacatcaatctttggataatgcggcgctattccagccgattacaaaatacagtgtagaa
gttcaagatgtaaaaaatataccggaagctgttacaaatgcatttaggatagcgtcagca
gggcaggctggggccgcttttgtgagctttccgcaagatgttgtgaatgaagtcacaaat
acgaaaaacgtgcgtgctgttgcagcgccaaaactcggtcctgcagcagatgatgcaatc
agtgcggccatagcaaaaatccaaacagcaaaacttcctgtcgttttggtcggcatgaaa
ggcggaagaccggaagcaattaaagcggttcgcaagcttttgaaaaaggttcagcttcca
tttgttgaaacatatcaagctgccggtaccctttctagagatttagaggatcaatatttt
ggccgtatcggtttgttccgcaaccagcctggcgatttactgctagagcaggcagatgtt
gttctgacgatcggctatgacccgattgaatatgatccgaaattctggaatatcaatgga
gaccggacaattatccatttagacgagattatcgctgacattgatcatgcttaccagcct
gatcttgaattgatcggtgacattccgtccacgatcaatcatatcgaacacgatgctgtg
aaagtggaatttgcagagcgtgagcagaaaatcctttctgatttaaaacaatatatgcat
gaaggtgagcaggtgcctgcagattggaaatcagacagagcgcaccctcttgaaatcgtt
aaagagttgcgtaatgcagtcgatgatcatgttacagtaacttgcgatatcggttcgcac
gccatttggatgtcacgttatttccgcagctacgagccgttaacattaatgatcagtaac
ggtatgcaaacactcggcgttgcgcttccttgggcaatcggcgcttcattggtgaaaccg
ggagaaaaagtggtttctgtctctggtgacggcggtttcttattctcagcaatggaatta
gagacagcagttcgactaaaagcaccaattgtacacattgtatggaacgacagcacatat
gacatggttgcattccagcaattgaaaaaatataaccgtacatctgcggtcgatttcgga
aatatcgatatcgtgaaatatgcggaaagcttcggagcaactggcttgcgcgtagaatca
ccagaccagctggcagatgttctgcgtcaaggcatgaacgctgaaggtcctgtcatcatc
gatgtcccggttgactacagtgataacattaatttagcaagtgacaagcttccgaaagaa
ttcggggaactcatgaaaacgaaagctctctag

DBGET integrated database retrieval system