KEGG   Bacillus subtilis subsp. subtilis 168: BSU28630
Entry
BSU28630          CDS       T00010                                 

Symbol
pheT
Name
(RefSeq) phenylalanine--tRNA ligase beta subunit
  KO
K01890  phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU28630 (pheT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU28630 (pheT)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU28630 (pheT)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     BSU28630 (pheT)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   BSU28630 (pheT)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU28630 (pheT)
 Prokaryotic type
    BSU28630 (pheT)
SSDB
Motif
Pfam: tRNA_synthFbeta B3_4 FDX-ACB tRNA_bind B5 VapB_antitoxin
Other DBs
NCBI-GeneID: 937445
NCBI-ProteinID: NP_390741
Pasteur: BG10875
BSORF: BG10875
UniProt: P17922 A0A6M4JKJ5
Position
complement(2927008..2929422)
AA seq 804 aa
MFVSYKWLEDYVDLKGMDPAVLAEKITRAGIEVEGIEYKGEGIKGVVIGHVLEREQHPNA
DKLNKCLVDIGAEAPVQIICGAPNVDKGQKVAVATVGAVLPGNFKIKKAKLRGEESNGMI
CSLQELGIESKLVAKEYAEGIFVFPNDAETGSDALAALQLDDAILELGLTPNRADAMNML
GVAYEVAAILDTEVKLPQTDYPAASEQASDYISVKIEDQEANPLYTAKIIKNVTIAPSPL
WMQTKLMNAGIRPHNNVVDITNFVLLEYGQPLHAFDYDRFGSKEVVVRKAAENEMIVTLD
DQERKLSADHLVITNGTKAQAVAGVMGGAESEVQEDTKTILLEAAYFNGQKVRKASKDLG
LRSESSVRFEKGIDPARVRLAAERAAQLIHLYAGGEVLAGTVEEDHLTIEANNIHVSADK
VSSVLGLTISKEELISIYKRLGFTVGEADDLLVVTVPSRRGDITIEEDLIEEAARLYGYD
NIPSTLPETAGTTGGLTPYQAKRRKVRRFLEGAGLSQAITYSLTNEKKATAFAIEKSLNT
VLALPMSEERSILRHSLVPNLLDSVSYNLARQTDSVALYEVGSVFLTKEEDTKPVETERV
AGAVTGLWRKQLWQGEKKPVDFFVVKGIVEGLLDKLNVLDSIEFVQSERKQLHPGRTANI
LLNGSLIGFIGQVHPSLEKELDIKETYVFELDLHALLAAETAPLVYTAIPKYPSVTRDIA
LVTDKTVTSGQLESVIKEAGGKLLKEVTVFDVYEGEHMEEGKKSVAFSLQYVNPEQTLTE
EEVTKAHSKVLKALEDTYQAVLRG
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgtttgtttcttataaatggttagaggattatgttgatttaaaaggcatggacccggct
gttcttgctgaaaaaattacaagagccggtattgaggttgaaggaattgaatacaaagga
gaaggcatcaaaggcgttgtcatcggccatgtgctggagcgcgagcagcacccgaatgct
gataagctgaataagtgccttgtggatatcggagctgaagcccctgtacaaatcatttgc
ggcgcgccgaatgtggataagggacaaaaagtcgcagttgcaacagtcggagcggtgctg
ccgggcaatttcaaaatcaaaaaagccaagcttcgcggtgaagaatcaaacggcatgatc
tgttccttacaggagcttggtatcgaaagcaaacttgtggcgaaggagtatgcagaaggc
attttcgtattcccgaatgacgctgaaacaggaagcgatgccttagcggctttacagctt
gacgatgcgattcttgagctgggtttaacgccaaaccgcgcggatgccatgaacatgctt
ggtgttgcttacgaggttgcggcgattttagacactgaggtaaagcttccgcaaacggat
tacccggctgcttcagaacaagcgtctgattacatttcagtcaaaattgaagatcaagaa
gcgaacccgctgtacactgcaaaaatcattaaaaatgtcacgattgctccgtcaccgctt
tggatgcagacaaagctgatgaatgcaggcattcgtccgcacaacaacgtcgttgacatc
acaaattttgtcctgttggaatacggacagccgcttcatgcgtttgattatgacagattt
ggctctaaggaagtcgtagtaagaaaagcagctgagaatgaaatgatcgtaacacttgat
gatcaagaacgtaagctgtctgccgatcaccttgtcattacaaacggaacgaaagcgcag
gccgttgccggtgtcatgggaggagcagagtcagaggttcaggaagatacgaaaaccatt
ttgcttgaggctgcgtatttcaacgggcagaaggttcgcaaggcttccaaagaccttggt
ttgagaagtgaatcaagcgtaagatttgaaaaaggaattgatccggcacgcgtacgtctt
gcagcagaacgggctgcgcagctgatccatctgtatgccggcggtgaggtgcttgctgga
acggttgaggaagatcacctgacaatcgaagcaaataacattcacgtatctgctgacaaa
gtgagcagcgttctaggcctgacgatcagtaaagaagaactgatcagcatttataaacgt
ctcggttttacggtcggtgaagcggatgatcttctcgttgtgactgtcccatcacggcgc
ggtgacattacaatagaagaggatttaatcgaagaagcggcaagactgtacggctacgat
aacattccgtctacgcttcctgagacagcgggaactacaggcggattaacgccatatcag
gcaaaacgccgtaaagtcagacgcttccttgaaggcgcaggcttatcacaagccatcact
tactcactgacaaacgagaagaaagcgacagcgtttgcgattgaaaaatcactgaatact
gtgcttgcgcttccaatgagtgaagaaagaagcattctcagacacagtcttgttccaaat
ctgcttgattctgtttcttacaatcttgcgaggcagactgactcagttgcactgtacgaa
gttggctccgttttcctaacgaaggaagaggacacaaaacctgttgaaacagaacgcgta
gcaggagctgttaccggattatggcgcaagcagctatggcagggtgaaaagaaaccagtt
gatttctttgttgtcaaaggaattgtggaagggctgttagacaaactcaacgtcctagac
agcattgaatttgtacagtctgaacgcaaacagctgcatccgggcagaacagcgaacatt
ttattgaatggttctctgatcggcttcatcggccaagtccatccttcattggaaaaagaa
ctggatataaaggaaacatacgtatttgagctcgatcttcatgcgttgctcgcagcagaa
acagcaccgcttgtttacacggcgattccaaaatatccgtctgtgacacgtgatatcgct
cttgtaacagataaaaccgtcacaagcggacagctcgagagcgtcattaaagaggccggg
ggcaagcttctgaaagaggtaaccgtatttgacgtatacgaaggagagcatatggaggaa
ggcaagaagtcagtcgctttctcactccagtatgtcaatcctgaacaaacactgactgaa
gaagaagtgacaaaggcgcacagcaaagtgctgaaagcgttagaagacacatatcaagct
gttttaagaggctga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU28640
Entry
BSU28640          CDS       T00010                                 

Symbol
pheS
Name
(RefSeq) phenylalanine--tRNA ligase alpha subunit
  KO
K01889  phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU28640 (pheS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU28640 (pheS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU28640 (pheS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     BSU28640 (pheS)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   BSU28640 (pheS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU28640 (pheS)
 Prokaryotic type
    BSU28640 (pheS)
SSDB
Motif
Pfam: tRNA-synt_2d Phe_tRNA-synt_N
Other DBs
NCBI-GeneID: 937987
NCBI-ProteinID: NP_390742
Pasteur: BG10874
BSORF: BG10874
UniProt: P17921 A0A6M3ZEU4
Position
complement(2929438..2930472)
AA seq 344 aa
MEEKLKQLEQEALEQVEAASSLKVVNDIRVQYLGKKGPITEVLRGMGKLSAEERPKMGAL
ANEVRERIANAIADKNEKLEEEEMKQKLAGQTIDVTLPGNPVAVGGRHPLTVVIEEIEDL
FIGMGYTVEEGPEVETDYYNFESLNLPKEHPARDMQDSFYITEETLMRTQTSPVQTRTME
KHEGKGPVKIICPGKVYRRDNDDATHSHQFMQIEGLVVDKNISMSDLKGTLELVAKKMFG
QDREIRLRPSFFPFTEPSVEVDVTCFKCGGNGCSVCKGTGWIEILGAGMVHPNVLKMAGF
DPKEYQGFAFGMGVERIAMLKYGIDDIRHFYTNDVRFISQFKQA
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggaagaaaagctaaaacagctggaacaagaagctttagaacaagtagaagcggcaagc
tcattgaaggttgtcaatgatattcgggtgcaatatctcggaaaaaaagggccgattaca
gaagtgctgcgcggaatgggcaagctttctgctgaggaacgtccaaaaatgggggcgctc
gcgaacgaagtaagggagcgtattgccaatgcgattgctgacaaaaacgagaagcttgaa
gaagaggaaatgaaacagaagcttgcaggacagacaattgacgtcacgctgccggggaac
cctgttgcagtcggcggccgccatccgctcactgttgtcattgaagaaattgaagattta
tttatcggtatgggctacacagtcgaggaagggccagaggttgaaacggattactacaac
ttcgaatcgctcaatcttccgaaagaacacccagcgcgcgatatgcaggacagcttttac
atcacagaggaaactttgatgagaacgcaaacttctcctgtccaaacacgtacgatggaa
aagcatgaaggcaaaggtcccgttaaaatcatttgcccgggtaaagtatatcgccgtgat
aacgatgatgcgacgcactctcaccaatttatgcaaattgaagggcttgtcgttgacaaa
aacatcagcatgagtgatttaaaaggaacgcttgaacttgttgcgaaaaaaatgttcggg
caagaccgtgaaatcagactccgcccaagcttcttcccgtttactgagccttcagtagaa
gtggatgtgacatgctttaaatgcggtgggaacggctgctcagtatgtaaaggaacaggc
tggattgaaatcctcggtgccggaatggttcacccgaacgtgcttaaaatggctggcttt
gatccgaaggaatatcagggcttcgcattcggaatgggtgttgagcgcatcgcgatgctg
aaatatggcattgatgatatccgccacttctatacaaacgatgtcagatttatttcgcag
tttaaacaggcgtaa

DBGET integrated database retrieval system