KEGG   Bacillus subtilis subsp. subtilis 168: BSU28850
Entry
BSU28850          CDS       T00010                                 

Symbol
rplT
Name
(RefSeq) 50S ribosomal protein L20
  KO
K02887  large subunit ribosomal protein L20
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU28850 (rplT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU28850 (rplT)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU28850 (rplT)
  Bacteria
    BSU28850 (rplT)
SSDB
Motif
Pfam: Ribosomal_L20
Other DBs
NCBI-GeneID: 936645
NCBI-ProteinID: NP_390763
Pasteur: BG11971
BSORF: BG11971
UniProt: P55873 A0A6M4JNN9
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
complement(2952224..2952583)
AA seq 119 aa
MPRVKGGTVTRKRRKKVLKLAKGYFGSKHTLYKVANQQVMKSGNYAFRDRRQKKRDFRKL
WITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVNDLTAFNQLADAAKAQLNK
NT seq 360 nt   +upstreamnt  +downstreamnt
atgccaagagtaaaaggcggaactgttacacgtaagcgtcgtaaaaaggttcttaaatta
gcaaaaggttatttcggttcaaaacatacattatacaaagtagctaaccagcaggtcatg
aaatctggaaactatgctttccgtgaccgtcgtcagaaaaaacgtgatttccgtaaactt
tggatcactcgtatcaacgcagctgctcgcatgaacggcctttcttacagccgtttaatg
cacggtcttaagctttctggtatcgaagtaaaccgtaaaatgcttgctgatcttgctgta
aacgatcttactgcattcaatcagcttgctgatgctgctaaagctcaattaaacaagtaa

DBGET integrated database retrieval system