KEGG   Bacillus subtilis subsp. subtilis 168: BSU28940
Entry
BSU28940          CDS       T00010                                 
Symbol
ysaA
Name
(RefSeq) hydrolase YsaA
  KO
K25528  phosphoserine phosphatase [EC:3.1.3.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BSU28940 (ysaA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU28940 (ysaA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     BSU28940 (ysaA)
SSDB
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like PGP_phosphatase Hydrolase_3
Other DBs
NCBI-GeneID: 936546
NCBI-ProteinID: NP_390772
Pasteur: BG12310
BSORF: BG12310
UniProt: P94512 A0A6M4JN09
Position
2958434..2959216
AA seq 260 aa
MKAVFFDLDDTLLWDEKSVRTTFAETCLQAEKKYGLAPEEFEAAVREAARELYMSYETYP
YTVMIGINPFEGLWSNFSEPISEGFQKLNKIVPEYRRNAWTNGLKALGIDDPAYGEYLGE
FFAAERRKRPFVYDETFAVLDQLKGKYELLLLTNGDPSLQKEKLAGVPELAPYFNEIVIS
GAFGKGKPDVSIFEHCLKLMNIEKDDAIMVGDNLNTDILGASRAGIKTVWINRTDKKNET
DVKPDYIISSLHDLFPILEK
NT seq 783 nt   +upstreamnt  +downstreamnt
atgaaagccgtattttttgatttagatgatacactactttgggacgaaaaaagcgtcaga
acaacatttgcagaaacttgcttacaggcggagaaaaaatatggccttgcccctgaggaa
ttcgaagcagctgttcgcgaagcggcgagagaattgtacatgtcatatgagacgtatcca
tatacagtgatgatcggcattaacccgtttgaaggactgtggtccaatttctcagagcca
atcagtgaaggctttcaaaagctgaacaagattgtgccggagtacagaagaaatgcatgg
accaacggactgaaagcgcttgggatcgatgatcctgcatatggcgaatacttgggagag
ttttttgcggcagagcgcagaaagcgcccgtttgtatatgatgaaacttttgctgtactc
gatcaattaaaaggcaagtatgaattattgcttttgacaaatggcgatcctagtctgcaa
aaggagaagcttgccggcgtgcctgagctcgctccttacttcaatgaaatcgtcatctcg
ggcgcattcggcaagggcaagccggatgtttcaatttttgaacactgccttaagctgatg
aatattgaaaaagacgatgccatcatggtcggcgataatttgaatactgatattttaggc
gcttcaagagccggaatcaaaaccgtttggatcaaccggactgataagaaaaacgaaact
gacgtaaagcctgattacatcatcagcagccttcatgatttgtttcctatattagagaaa
taa

DBGET integrated database retrieval system