KEGG   Bacillus subtilis subsp. subtilis 168: BSU28950
Entry
BSU28950          CDS       T00010                                 

Symbol
thrS
Name
(RefSeq) threonine--tRNA ligase 1
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU28950 (thrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU28950 (thrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU28950 (thrS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     BSU28950 (thrS)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   BSU28950 (thrS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU28950 (thrS)
 Prokaryotic type
    BSU28950 (thrS)
SSDB
Motif
Pfam: tRNA-synt_2b HGTP_anticodon tRNA_SAD TGS DUF5748
Other DBs
NCBI-GeneID: 937410
NCBI-ProteinID: NP_390773
Pasteur: BG10362
BSORF: BG10362
UniProt: P18255 A0A6M3ZEW6
Position
complement(2959257..2961188)
AA seq 643 aa
MSDMVKITFPDGAVKEFAKGTTTEDIAASISPGLKKKSLAGKLNGKEIDLRTPINEDGTV
EIITEGSEEGLQIMRHSAAHLLAQAIKRIYKDVKFGVGPVIENGFYYDVEMDEAITPEDL
PKIEKEMKKIVNANLPIVRKEVSREEAKARFAEIGDDLKLELLDAIPEGETVSIYEQGEF
FDLCRGVHVPSTGKIKEFKLLSLAGAYWRGDSKNQMLQRVYGTAFFKKADLEEHLRMLEE
AKERDHRKLGKELKLFANSQKVGQGLPLWLPKGATIRRVIERYIVDKEISLGYEHVYTPV
LGSKELYETSGHWDHYQEGMFPPMEMDNETLVLRPMNCPHHMMIYKQDIHSYRELPIRIA
ELGTMHRYEMSGALSGLQRVRGMTLNDAHIFVRPDQIKDEFIRTVRLIQDVYEDFGLSDY
TFRLSYRDPEDTEKYFDDDEMWNKAQSMLKEAMDEIGHDYYEAEGEAAFYGPKLDVQVKT
AIGKEETLSTVQLDFLLPERFDLTYIGEDGKQHRPVVIHRGVVSTMERFVAFLIEEHKGA
LPTWLAPVQFQVIPVSPAVHLDYAKKVQERLQCEGLRVEVDSRDEKIGYKIREAQMQKIP
YMLVVGDQEAENGAVNVRKYGEQNSETISLDEFVKKAVAEAKK
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgtcagatatggtaaaaatcacatttcctgatggagcagtcaaggagtttgcgaaagga
acaacaacagaagatatcgcggcatccatcagtccgggattaaagaaaaagtcattagcc
ggaaaactgaacggaaaagaaatcgatttgagaacgccgatcaatgaagacggtacagtg
gaaatcattacagaaggctcagaagaaggtcttcaaattatgcgccacagtgcggctcac
ttgctggctcaagcgattaaacgcatctacaaggatgttaaattcggcgtcggtccggtt
atcgaaaacggtttttactacgatgtagaaatggacgaagcgattacaccggaggatctg
ccgaaaatcgagaaagaaatgaaaaaaatcgttaatgcgaaccttccgatcgttcgaaaa
gaagtcagccgtgaagaagcgaaagcccgttttgcggaaatcggcgacgacctgaagctt
gaactattggatgcgattcctgaaggagaaaccgtttcgatctatgagcaaggcgaattc
tttgacctgtgccgcggcgtccatgttccttcaaccggaaaaatcaaagaatttaagctg
ttaagccttgcaggcgcatactggcgcggtgacagcaaaaaccaaatgcttcagcgcgta
tatggtacagctttcttcaaaaaagctgatcttgaagagcatcttcgtatgctagaagaa
gcgaaagaacgcgaccacagaaagcttggcaaagaattaaagctgttcgcgaactctcaa
aaagtcggacaaggcctgccgctttggctgccaaaaggcgcaacaatccgccgcgtcatc
gagcgctacattgtcgataaagaaatcagcctcggctatgagcacgtatacacacctgtg
ctaggcagcaaagagctgtatgaaacatcaggacactgggatcattatcaggaaggcatg
ttccctccgatggaaatggacaatgaaacacttgtattgcgtccgatgaactgtccgcac
catatgatgatttacaaacaagacattcacagttaccgcgagcttccgattcgtattgca
gagcttggaacgatgcaccgctatgaaatgtcaggtgcgctgtcaggacttcaacgggta
cgcggaatgacgttaaatgatgcacacatctttgtgcgcccggatcaaattaaggatgag
tttatccgtacagtccgtttaatccaggatgtttatgaagacttcggtttaagtgattac
acattccgtctgtcttaccgcgatccggaagatacagagaaatattttgatgacgatgaa
atgtggaacaaagcgcaatccatgctgaaagaggcaatggatgaaatcggccacgactat
tacgaagcagaaggtgaagcggcattctacggacctaaacttgatgttcaggtgaaaact
gcgatcggaaaagaagaaacactgtctacggttcagcttgatttcttattgccggaacgt
ttcgacctgacatacatcggtgaggacggcaagcagcaccgtccggttgtcattcacaga
ggtgtcgtttcaacaatggaacgctttgttgctttcttaatcgaagaacacaaaggcgcg
ctgccgacatggcttgcaccggttcagttccaagtcatcccggtttctccggctgtgcat
ttagactacgcgaaaaaagtgcaggaacgcctgcaatgtgaaggcctgcgtgttgaagtc
gacagccgcgatgaaaaaatcggctacaaaatccgtgaagcgcaaatgcaaaaaatcccg
tacatgctggtggtcggtgaccaagaagcagaaaacggagcggtaaacgtgcgtaaatac
ggagaacagaactctgaaaccatttcacttgatgagtttgtgaaaaaggcagtagctgaa
gcgaaaaaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU37560
Entry
BSU37560          CDS       T00010                                 

Symbol
thrZ
Name
(RefSeq) threonine--tRNA ligase 2
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU37560 (thrZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU37560 (thrZ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU37560 (thrZ)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     BSU37560 (thrZ)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   BSU37560 (thrZ)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU37560 (thrZ)
 Prokaryotic type
    BSU37560 (thrZ)
SSDB
Motif
Pfam: tRNA-synt_2b HGTP_anticodon tRNA_SAD TGS STN
Other DBs
NCBI-GeneID: 937135
NCBI-ProteinID: NP_391636
Pasteur: BG10421
BSORF: BG10421
UniProt: P18256 A0A6M4JQA6
Position
complement(3854256..3856172)
AA seq 638 aa
MSKHVHIQLPDGQIQEYPKGITIKEAAGSISSSLQKKAAAGQVNGKLVDLSFKLEEDAEL
SIVTLDSQEGLQVLRHTTAHVLAQAVKRLYGEVSLGVGPVILDGFYYDMKLGKSLASGDL
EAIEKEMKNIINENLEIKRIEVSYEEAEELFAQKDERLKLEILKDIPRGEDITLYQQGEF
VDLCRGPHLPSTGMIKAFKLTRVSGAYWRGDSKNEVLQRVYGVAFQKKKDLDAHLHMLEE
AAKRDHRKLGKQLGLFMFSEEAPGMPFYLPKGQIVRNELERFSRELQTNAGYDEVRTPFM
MNQRLWEQSGHWDHYRDNMYFSEVDDTRFAMKPMNCPGHMLIFKNSLYSYRDLPIRMAEF
GQVHRHEYSGALNGMLRVRTFCQDDAHIFVREDQIESEIKEAIRLIDEVYRTFGFEYSVE
LSTRPEDSLGDDSLWEASERALARVLEELGLSYEINEGDGAFYGPKIDFHIKDALKRSHQ
CATIQLDFQMPEKFDLTYINELNEKVRPVVIHRAVFGSIDRFFGILIEHYGGAFPVWLAP
IQVQIIPVSHVHLDYCRKVQAELKQAGIRAGIDERNEKLGYKIRESQVQKIPYVLVLGDH
EEQENAVNVRRFGHQQNEHVPFQTFKDKLVKQVENRGM
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgagcaaacatgtacacattcagcttccggacggacagatccaggaatatccgaaaggc
atcacaatcaaagaagcggctggttcgatcagttccagtctgcaaaagaaggcggccgca
ggtcaggtcaacggcaagcttgttgatctcagtttcaagctggaggaggatgctgagctt
tcgattgtcacactcgattcacaagaaggcttgcaggtgcttcgccacacaacagcgcac
gtgctggcccaagcagtaaaacggctgtacggcgaagtgtcattgggggtagggcctgtg
attttagacggcttctactatgacatgaagctggggaaaagcttggcatcaggagactta
gaggccatcgaaaaagaaatgaaaaacataataaatgagaaccttgaaatcaaacgtata
gaggtttcttacgaagaagctgaagagctgtttgcacaaaaagacgagcggctcaagctt
gagattttaaaggatattccgcgcggggaggatatcacactgtaccagcaaggggaattc
gttgacctgtgccgagggccgcatcttccttctacagggatgatcaaggcgttcaaactg
acaagagtatcaggcgcttattggcgcggagacagcaaaaatgaagtcctgcagcgggtg
tacggggttgcgtttcaaaagaaaaaagatttggatgcgcacctgcatatgctagaagaa
gcggcaaaacgagaccatcgcaagctcggcaaacagttagggctgtttatgttttctgaa
gaagcgccggggatgccgttttatttgccgaaagggcagattgtccgcaatgagctggag
cgcttctcgcgtgagctgcaaacaaatgccggctacgatgaggtgcgtacgccgtttatg
atgaatcagcggttatgggagcagtcaggccattgggaccattatcgcgacaatatgtac
ttttcagaagtggatgatacaagattcgcaatgaagccgatgaattgccccggccacatg
ctcatctttaaaaacagcctgtattcttatcgggatctgccgattcgcatggcggaattc
ggacaggtgcaccgccatgaatacagcggcgctttaaacggaatgcttcgcgttcggacg
ttctgtcaggatgacgcccatattttcgttcgggaggatcagattgagagtgagatcaaa
gaagcgattcggctgattgatgaggtatatcggacatttggtttcgagtattctgttgag
ctttcgactcgcccggaggattcattaggcgatgacagcctttgggaagcgtcggaacgt
gccttagcacgcgtccttgaggagcttggcctctcttatgagatcaatgaaggcgatggg
gcgttttacgggccgaaaattgatttccatataaaagatgccctgaaacggagccaccaa
tgcgcgacaattcagcttgattttcaaatgccggaaaaatttgatttaacatatatcaac
gaactcaatgagaaggttcgtcccgttgtcatccacagagcggttttcggctcaatcgac
cgtttcttcggcattttgatcgagcattacggtggggcttttccagtctggctcgcaccg
atccaggttcaaatcataccggtttcgcacgttcacttagactattgcagaaaagtgcag
gcggagctgaagcaggcggggataagagccggcattgatgagcgcaatgagaagctcggc
tataaaatcagagaatcgcaggtgcaaaaaattccgtacgtgctggtgcttggagatcat
gaggagcaggagaatgcggtaaacgtccgccgattcggacatcagcagaatgaacacgtt
cctttccaaacttttaaagataaacttgtgaaacaggtggaaaatcgaggcatgtag

DBGET integrated database retrieval system