KEGG   Bacillus subtilis subsp. subtilis 168: BSU29060
Entry
BSU29060          CDS       T00010                                 

Symbol
coaE
Name
(RefSeq) dephospho-CoA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU29060 (coaE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     BSU29060 (coaE)
SSDB
Motif
Pfam: CoaE AAA_18 AAA_33 Cytidylate_kin2 dNK AAA_17 Dynamin_N ANTAR AAA_28 APS_kinase Zeta_toxin
Other DBs
NCBI-GeneID: 937388
NCBI-ProteinID: NP_390784
Pasteur: BG13824
BSORF: BG13824
UniProt: O34932 A0A6M4JNX1
Position
complement(2970922..2971515)
AA seq 197 aa
MTLVIGLTGGIASGKSTVANMLIEKGITVIDADIIAKQAVEKGMPAYRQIIDEFGEDILL
SNGDIDRKKLGALVFTNEQKRLALNAIVHPAVRQEMLNRRDEAVANREAFVVLDIPLLFE
SKLESLVDKIIVVSVTKELQLERLMKRNQLTEEEAVSRIRSQMPLEEKTARADQVIDNSG
TLEETKRQLDEIMNSWA
NT seq 594 nt   +upstreamnt  +downstreamnt
ttgaccttagtcattggtttaacgggaggaatagctagcggcaaaagcacggtagccaat
atgctgattgaaaaaggaataacagttatagatgcagatatcattgcaaaacaagcggta
gaaaaagggatgccggcctaccggcaaatcattgacgaattcggtgaagacatactgctc
tcaaatggcgatatagatagaaaaaagcttggagcgctggtatttacaaatgaacaaaaa
cgtctcgctttaaatgcaattgttcatcccgcagtcaggcaggaaatgctcaatcgccgt
gatgaagccgttgcaaatcgggaggcatttgttgtattggatatcccgctattgttcgaa
agcaaattggaatcattggttgataaaattattgtggtcagtgtgacaaaagagcttcaa
ctggaacgtctgatgaagcgcaatcagctgacagaagaagaagcagtcagccgtatccgc
tctcaaatgcccttagaggaaaaaacagcaagagcagatcaagtcattgataacagcggc
acgcttgaagagaccaaaaggcagcttgatgaaatcatgaacagctgggcataa

DBGET integrated database retrieval system