KEGG   Bacillus subtilis subsp. subtilis 168: BSU29350
Entry
BSU29350          CDS       T00010                                 

Symbol
tcyM
Name
(RefSeq) L-cystine transport system permease protein TcyM
  KO
K16959  L-cystine transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU29350 (tcyM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU29350 (tcyM)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   L-Cystine transporter
    BSU29350 (tcyM)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 935938
NCBI-ProteinID: NP_390813
Pasteur: BG13887
BSORF: BG13887
UniProt: O34931 A0A6M3ZFF4
Position
complement(3005122..3005829)
AA seq 235 aa
MQFDFPFIVSAMKEMVKTIPLTLMMAVLPIVFGFLVALGNIIVRIFRIKGLVACSRFYVS
FFRSTPAILHIMLIYLGIPPVADQVSSFFHLGWSANEIPVSMFVIMALSLTAGAYLTEII
RSGILAMDTGQVEAAYSIGLTYSQTFRRVILPQALKVSIPNFTNLGIGFLHTTSIAAIVA
VPEITGTATIVASDNYAFLEAFIGAAIIYWVLTLILESANGVLERKAARFQGGTL
NT seq 708 nt   +upstreamnt  +downstreamnt
ttgcaatttgactttccatttatcgtttccgccatgaaagaaatggtaaagaccattcct
ctgacattgatgatggctgttttgccgattgtgtttggatttctcgtggctcttggaaat
ataattgttagaatttttagaattaagggcttggtggcttgctcaaggttttatgtgtct
ttctttcgaagtacacctgcaattcttcacattatgttgatttatttagggataccgcct
gttgcagatcaagtcagcagtttttttcatctcggctggtccgctaatgagataccggtc
tccatgtttgtcatcatggccttgtctttaactgccggagcttatctcacagaaatcatc
cggtcgggcattctggcgatggataccggacaggtcgaagcggcttattcaatcggcttg
acatacagccaaacctttcggcgtgtaatattgccgcaggcgctgaaggtttccatccca
aacttcacaaatttgggtatcggctttttgcataccacctctatcgcggctatagtggct
gtcccagagattacagggacggcgactatcgttgcttctgataattatgcatttttagaa
gcgtttatcggagcagcgattatctattgggtgctgactctaatcctagaatccgcaaat
ggagtattagagagaaaggcagccagatttcaaggaggcactttatga

DBGET integrated database retrieval system