KEGG   Bacillus subtilis subsp. subtilis 168: BSU29580
Entry
BSU29580          CDS       T00010                                 

Symbol
ytbJ
Name
(RefSeq) tRNA sulfurtransferase
  KO
K03151  tRNA uracil 4-sulfurtransferase [EC:2.8.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
bsu04122  Sulfur relay system
Module
bsu_M00895  Thiamine biosynthesis, prokaryotes, AIR (+ DXP/glycine) => TMP/TPP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU29580 (ytbJ)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BSU29580 (ytbJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU29580 (ytbJ)
Enzymes [BR:bsu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.4  tRNA uracil 4-sulfurtransferase
     BSU29580 (ytbJ)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BSU29580 (ytbJ)
SSDB
Motif
Pfam: ThiI THUMP QueC UPF0227
Other DBs
NCBI-GeneID: 937471
NCBI-ProteinID: NP_390836
Pasteur: BG13827
BSORF: BG13827
UniProt: O34595 A0A6M3ZFA6
Position
complement(3025748..3026953)
AA seq 401 aa
MNYDHILIRFGEISTKGKNRKSFIERLKQNIRLVLKDYPNLKYFSNRDRMTITLNGEDPE
ALFPHLKQVFGIQSFSLAIKCDSRLDDIKATALKAIKDQYKPGDTFKVATKRAYKQFELD
TNQMNAEIGGHILRNTEGLTVDVRNPDIPLRIEIREEATFLTIRDEKGAGGLPVGSAGKA
MLMLSGGFDSPVAGFYAMKRGLSVEAVHFFSPPYTSERAKQKVMDLAKCLSRFGGSMTLH
IVPFTKTQELIQKQIPENYTMTATRRLMLQIADRIREKRNGLAIITGESLGQVASQTLES
MYAINAVTSTPILRPLIAMDKTEIIEKSREIGTYETSIQPFEDCCTIFTPPSPKTRPKKE
KIEHFESFVDFEPYIQEAVDNIETMTLYSEQEANDKFAELF
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaattacgatcatatattaattcgttttggggaaatttcgaccaaaggcaaaaacaga
aaaagctttattgagcgcttaaaacaaaacatcagactcgttttgaaagactatccgaat
ttaaaatacttttccaacagggatcgtatgacgattacattaaatggagaggatcctgag
gctctttttcctcatttaaagcaagtgtttgggattcaaagcttcagcctggcaattaag
tgtgacagccgccttgatgatattaaggcaaccgcactaaaggctatcaaagatcagtat
aaaccaggtgatacgtttaaagtcgcgacaaagagagcgtataagcaatttgaattagat
acaaaccagatgaacgctgaaatcggcggccatattttgcgaaatacagaaggattgacg
gtcgatgttcgcaacccagacatcccgctcagaatcgaaatcagggaagaagcaacattt
ttgacaattcgtgatgaaaaaggtgcaggcgggctgccagttggttcagcaggaaaagcg
atgctgatgctttctggcggttttgacagccctgtggccggtttttatgcgatgaaacgg
ggattgtcggtagaagctgttcatttcttcagcccgccatacacaagcgagcgcgcaaag
caaaaggtaatggatctggcgaaatgtctgtcccgttttgggggaagcatgacacttcat
attgttccatttacaaaaacgcaagagctcatccaaaaacaaattcctgaaaattacaca
atgacggcaacccgccgcctcatgcttcagatagccgacagaatcagagaaaagagaaac
gggcttgccattattacgggagaaagcctcggtcaggtagcgagccaaacgcttgaaagc
atgtatgcaattaatgcggtgacgtcaacaccgattttgcgtccgctaatcgccatggac
aaaacagaaatcatcgaaaaatcacgggaaattggcacatatgagacaagtattcagccg
tttgaagactgctgcacgatctttacaccgccaagcccgaaaacacgccctaaaaaagag
aaaattgaacactttgaaagctttgttgatttcgagccgtatattcaagaagcggtagat
aacattgagacaatgaccctttatagcgaacaagaagctaacgataaattcgctgaactc
ttttaa

DBGET integrated database retrieval system