KEGG   Bacillus subtilis subsp. subtilis 168: BSU29980
Entry
BSU29980          CDS       T00010                                 

Symbol
ytjP
Name
(RefSeq) dipeptidase YtjP
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00300  Lysine biosynthesis
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BSU29980 (ytjP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU29980 (ytjP)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BSU29980 (ytjP)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M20
   BSU29980 (ytjP)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Other DBs
NCBI-GeneID: 937290
NCBI-ProteinID: NP_390876
Pasteur: BG13867
BSORF: BG13867
UniProt: O34944 A0A6M4JL79
Position
complement(3067420..3068811)
AA seq 463 aa
MNWEVEVIRKKEDLIRDTQEFLRINSVMDETTAGPGKPFGEGVNASLTSLLELGEKEGFT
TKNLDGFAGHIEWGEGDDIIGVLCHVDVVPPGDGWTSDPFSAEIRNGRIYARGAIDDKGP
TMAAFYALKIVKDMNLPLSKRVRMIIGTDEESDWRCVEHYFKHEEMPTMGFAPDADFPII
NAEKGIIDASLLIPHRPNQAEPKAVLVSFQSGLRLNMVPDAAEAVIEGPKNEEILSSFKD
MLRTTDQKGEAAIENGQLILRMYGLSCHAMEPNNGINAGILLCEFLQQTELDDAGKRFVQ
VVTDKFSGDTRGKKLDIDCEDEISGELTLNVGTLRYKEGQGGELGINIRYPVTAESKVIR
DTFESASEFELGEFKDSKPHHVSADHPLVKTLQKVYEGQLGKKADLISIGGGTYARSLKA
GVAFGPLFPGRPDSAHQKDEYIEIDDLLRSTALYAQAIYELAK
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgaactgggaagttgaagtgatcagaaaaaaagaggatttaattcgtgatacacaggaa
tttttgagaatcaacagtgtcatggacgaaacaaccgccggacccggtaaaccgtttgga
gaaggggtaaatgccagcctgacttcattgctggagcttggagaaaaagaaggctttaca
acaaaaaatcttgacggcttcgcaggtcatattgaatggggggagggcgatgacattatc
ggcgtactttgccatgttgacgtcgtgccgccgggagatgggtggacgagtgatccattt
tcagctgaaatccgcaacggacggatttatgcaaggggcgccattgatgacaaaggcccg
acaatggcggcattctacgcgctgaaaatcgtgaaagacatgaatttgcccctgtccaag
cgagtcagaatgattatcggaacagatgaagaaagtgattggagatgcgtagagcattat
ttcaagcatgaagaaatgccaacaatgggctttgcgcctgacgccgattttccgatcatt
aatgcggaaaaagggatcatcgatgcttctttacttattccgcaccgcccaaatcaagct
gaaccaaaggcagtgcttgtctcgtttcaatcaggccttcgcttaaacatggtgcccgac
gctgcggaagctgtcattgaagggccgaaaaatgaagagattctgtcttcatttaaagac
atgctccgcacgacggaccaaaaaggggaagctgcaatagagaacggacagctcattttg
cgtatgtacggtctttcctgccatgcgatggaaccgaacaatgggatcaatgccggcatt
ttattgtgcgaatttctccagcagactgagcttgacgatgcaggaaagcggtttgtgcaa
gttgtgacagataagttctcaggtgatacaagaggaaaaaaactggacatcgactgtgag
gatgaaatcagcggagagctgacattaaatgtcggaacactgcgctataaagaagggcaa
ggaggcgagctcgggatcaatatccgctatcctgtgacagcagaaagcaaagtgatccgc
gatacattcgaaagcgcatctgaatttgagctgggagaattcaaagacagcaagccgcat
cacgtgtccgcagatcatccgttagtcaaaaccctgcaaaaggtttatgaaggccagctg
ggtaaaaaagctgatttaatctcaatcggcggggggacttatgcgagatccttaaaagcc
ggtgtcgcgttcggcccgctgttccccggacgccctgacagcgcacaccaaaaggatgaa
tatatcgaaattgatgacctgctgagatcgacagcgttatatgctcaggccatttacgag
cttgcaaaataa

DBGET integrated database retrieval system