KEGG   Bacillus subtilis subsp. subtilis 168: BSU30710
Entry
BSU30710          CDS       T00010                                 

Symbol
ythA
Name
(RefSeq) cytochrome bd menaquinol oxidase subunit I
  KO
K00425  cytochrome bd ubiquinol oxidase subunit I [EC:7.1.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU30710 (ythA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU30710 (ythA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)
     BSU30710 (ythA)
SSDB
Motif
Pfam: Cyt_bd_oxida_I
Other DBs
NCBI-GeneID: 937142
NCBI-ProteinID: NP_390949
Pasteur: BG13857
BSORF: BG13857
UniProt: C0SP90 A0A6M4JKR8
Position
3139431..3140762
AA seq 443 aa
MDDLVLARSLFGTTMGFHIIFATLGVGLPLMILVAELIYQKTKDDHYAIMAKRWTKAQAV
LLGVAIPTGTIAGTQLALLWPGFMEVIGRVMSLPFQIEIYAFFVEALFMSIYVYAADRLS
PAMRIVAVFFVLVGAAASAVLITNVHAFEGTPAGFKILNGKITDVDPWAAFFNPSFFITA
GHVVLSAFMTGAFIVASVAAYKMIRTRKKERVYRFHRKALLLALTIGGIFSLLTALNGHE
SAQMLYEYQPEKLAGAEGLFETRSHAPLAIGGFTDPNEEKVKWAIEIPWALSFLAANRFD
TVVKGLNAFPRDEWPPLFIHTLFNAMVGVGMLLILYSIIGVVWRKVLKKDRFPTWLLIIF
MTAGPFSLIGIEFGWIFACTGRQPWVIYHLLKTSDVVTTTGSIGVLFLFFTFVYAVLGAA
VVYVLLYYFRKHPVDEDLNTAES
NT seq 1332 nt   +upstreamnt  +downstreamnt
gtggatgatttagttttggccagaagcctttttggcacgacgatgggctttcatatcatt
ttcgcaacacttggagtcggtctgccgctcatgattttagtggcggaattgatctatcaa
aaaacgaaagatgaccattatgcgatcatggcgaaaagatggacgaaagcacaagccgtt
ttgctgggggtcgccataccgaccggaacgatcgcgggcactcagctcgcgcttttatgg
ccgggatttatggaagtcatcggccgggtgatgtccctgccatttcaaattgaaatctat
gctttttttgttgaagccctattcatgtcgatttatgtatacgctgcagaccgtttgtca
cctgcaatgaggattgttgctgttttctttgtgttagtcggggcagcagcatccgctgtt
ctgatcacgaatgttcacgcttttgaaggtacgcccgccggttttaaaattttaaacgga
aaaattacagatgttgacccgtgggctgcgttttttaatcctagcttttttatcactgcc
ggccatgtcgtgctgtccgcgtttatgactggtgcgtttatcgtggcttctgttgcggcg
tataaaatgatccgaacgaggaaaaaggaaagggtctatcgctttcaccggaaagccctt
ttgctcgcactgacgatcggcggtattttttcattgctgaccgctttgaacggacacgaa
tctgcacagatgctgtacgaataccagcccgaaaaattagccggtgcggaaggcctattt
gaaacaagatcccacgccccgctcgctatcggcggttttaccgacccgaatgaagaaaaa
gtaaaatgggcaatcgagattccatgggctttaagctttttggcagcgaaccgttttgac
actgttgtaaaaggattaaatgcatttccgagagatgaatggccgccgcttttcattcac
acgctgtttaatgcgatggttggtgtaggcatgctgctaattctttattccattatcggt
gtggtctggagaaaggtgctcaagaaagaccgtttcccaacgtggcttttgatcattttc
atgacagcaggcccttttagtctcatcggcattgaattcggctggattttcgcatgtacg
gggaggcagccttgggtcatctatcatctgctgaaaacgtcagatgtcgtaacaacgact
ggctcgatcggggtgctgttcttatttttcacatttgtttatgccgtgttaggcgcagct
gtcgtctacgtgctgctgtattatttccgcaagcacccggttgacgaagatttaaataca
gcggagtcgtaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU38760
Entry
BSU38760          CDS       T00010                                 

Symbol
cydA
Name
(RefSeq) cytochrome d ubiquinol oxidase subunit 1
  KO
K00425  cytochrome bd ubiquinol oxidase subunit I [EC:7.1.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU38760 (cydA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU38760 (cydA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)
     BSU38760 (cydA)
SSDB
Motif
Pfam: Cyt_bd_oxida_I
Other DBs
NCBI-GeneID: 937406
NCBI-ProteinID: NP_391755
Pasteur: BG11925
BSORF: BG11925
UniProt: P94364 A0A6M3ZHS0
Position
complement(3977791..3979197)
AA seq 468 aa
MSELVLARIQFASTTLFHFLFVPMSIGLVFMVALMETLYLVKKNELYLKMAKFWGHLFLI
NFAVGVVTGILQEFQFGLNWSDYSRFVGDVFGAPLAIEALLAFFMESIFIGLWIFGWDRL
PKKIHALCIWLVSFGTIMSSFWILTANSFMQEPVGFTIKNGRAEMNDFGALITNPQLWVE
FPHVIFGALATGAFFIAGVSAFKLLKKKEVPFFKQSFKLAMIVGLCAGLGVGLSGHMQAE
HLMESQPMKMAASEGLWEDSGDPAAWTAFATIDTKNEKSSNEIKVPYALSYLAYQKFSGS
VKGMKTLQAEYEKIYGKGDYIPPVKTTFWSFRIMVGAGVVMILAALGGLWLNRRKKLENS
KWYLRIMIALISFPFLANSAGWIMTEIGRQPWTVMGLMTTAQSVSPNVTAGSLLFSIIAF
GVMYMILGALLVFLFIREIKKGAEHDNHHDVPVSTDPFSQEVYHGISS
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgagtgaattggtattagcccgcatacaatttgcatcaacaacgttgtttcacttcttg
tttgtgccgatgtctatcgggcttgtgtttatggttgcgttgatggagactctttatctt
gtaaagaaaaatgagctgtatctcaaaatggcaaagttttggggacacttattcttaata
aatttcgcagtcggtgttgtaacggggattttgcaagaattccagtttggactgaactgg
tcagattactcccgttttgtcggagatgtatttggcgctccgcttgcgattgaagcatta
ttggcgtttttcatggaatctatttttatcggattatggatttttggctgggaccgcctg
ccgaagaaaattcacgcgctctgcatatggctcgtatcattcggaacgatcatgtcatct
ttctggattttaacagcaaactcctttatgcaggagccggtcggctttacgatcaaaaac
ggccgcgcggaaatgaatgattttggcgcgttgattacaaaccctcagctttgggttgaa
ttcccgcacgttattttcggtgcgcttgccactggagctttctttattgccggagtgagt
gcttttaaactgctgaagaaaaaagaagtgccgttctttaagcaatcttttaaactcgca
atgatcgtcggtctttgtgccggtcttggcgtcggccttagcggacacatgcaggctgag
cacttgatggaatcacagccgatgaaaatggctgccagtgaaggcctatgggaagacagc
ggtgaccctgctgcttggaccgcttttgcgacgatcgatacaaaaaatgaaaaaagctca
aatgaaatcaaagttccttatgccttgagctacttggcttatcagaaattcagcggaagt
gtcaaagggatgaaaacccttcaggctgagtacgaaaaaatatacggaaaaggcgactac
attccgccagtgaaaacgacattctggagcttccgcatcatggtaggagcaggtgttgtc
atgattcttgctgcgttaggcggcctttggttaaaccgccgtaaaaagcttgaaaacagc
aaatggtatttgcgcatcatgatcgcgttgatttccttcccgtttcttgcaaactccgcg
ggctggattatgacagaaatcggacgtcagccttggacggttatggggttaatgacaacc
gctcaatctgtgtcgcctaacgtaacagcgggttccttgttattctcaatcatcgcattc
ggtgtgatgtacatgattcttggtgcactgcttgtcttcttgtttatccgtgagattaaa
aaaggtgcggagcatgataatcatcatgatgtgcctgtatcaacagatccatttagtcag
gaggtataccatggcatctcttcatga

DBGET integrated database retrieval system