KEGG   Bacillus subtilis subsp. subtilis 168: BSU30950
Entry
BSU30950          CDS       T00010                                 

Symbol
glgA
Name
(RefSeq) glycogen synthase
  KO
K00703  starch synthase [EC:2.4.1.21]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU30950 (glgA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsu01003]
    BSU30950 (glgA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     BSU30950 (glgA)
Glycosyltransferases [BR:bsu01003]
 Polysaccharide
  Storage polysaccharide
   BSU30950 (glgA)
SSDB
Motif
Pfam: Glyco_transf_5 Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Tuberculin
Other DBs
NCBI-GeneID: 936781
NCBI-ProteinID: NP_390973
Pasteur: BG10910
BSORF: BG10910
UniProt: P39125 A0A6M3ZFX3
Position
complement(3166118..3167572)
AA seq 484 aa
MKILFAVSECTPFVKSGGLADVAGALPKALARLGNEVAVMLPKYSQIPEPWKKRMKKQAE
CTVAVGWRQQYCGIEHMAENDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAK
VVNVQADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLL
GLEMDHFHYERLECNGFVNFMKAGIIAADHVTTVSPTYRNEIMTPYYGEQLEQVLQYRED
DVTGILNGIDDTFYQPKSDPYIEAQYDSGDLACKLENKTKLQQRMGLPEKNDIPLISMVT
RLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEP
LAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGF
TFSAFNAHDLKFTIERALSFYCQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGR
DVLE
NT seq 1455 nt   +upstreamnt  +downstreamnt
ttgaagatattatttgctgtgtcagaatgcaccccatttgtgaaatcaggaggtcttgcc
gatgtagcaggtgctctgccaaaggcgcttgcgcgattaggcaatgaggtagctgtgatg
ctgccgaagtacagccaaatacctgaaccgtggaaaaagcgtatgaaaaaacaggctgag
tgtaccgtagctgtcggctggcggcagcaatattgcggaattgaacatatggcagagaat
gatgtgaattattacttcatcgacaatgagtactatttcaacagggattcgttgtacggg
cattatgatgacggtgagcggtttgcctttttttcaagagctgtgctggaggctgccaaa
gttgtgaatgttcaagccgatattgttcatactcacgattggcatacagcgatggtcaat
tatttgctgaaagaggagtacagaaaacatcctttttatgaacggatgaaaagcgtgctc
acgatccacaacctgcagtttcaaggcatattccctcctgatgtcacacatgacttgctg
ggtcttgagatggatcattttcattatgaaaggttagaatgcaacggatttgttaatttt
atgaaagcgggcatcattgcggctgatcatgtgacaactgtgagccccacttacagaaat
gaaatcatgacgccgtattatggtgagcagttggaacaggttttgcaatatagggaagat
gatgtaaccggcatattaaatggcattgatgatacgttctatcagccgaaaagcgaccct
tatatagaggcgcaatacgattcaggggatcttgcatgcaagctggaaaacaaaacgaag
cttcagcagcggatggggcttccagagaaaaacgatattccgctgatcagtatggtgaca
aggctcactaaacaaaaggggcttgatcttgtccgcagaattatgcacgaacttcttgag
gagcaagacatacagctggttgtgctaggcacaggagaacgtgaatttgaagattatttc
cggtatgcagaatttgcttttcatgagaagtgccgggcttatatcgggtttgatgagccg
ctagcccatcaaatttatgcgggctctgatatgtttttgatgccgtcgaaatttgagccg
tgcggtttggggcagctcattgctcttcaatatggcgccattccgattgtcagggaaacg
ggcggtctttacgacactgtccgtgcctatcaggaggaagagggaacgggcaatggcttt
acgttttccgcctttaatgcgcatgatctgaaatttacgatagaaagggcgctgtcgttt
tattgccaacaggatgtatggaagagcatcgtgaagaccgctatgaatgcagattacagc
tgggggaagtcggctaaagagtatcagcgtattttcgagcaggtgacaaggagtggacgg
gatgttctcgagtaa

DBGET integrated database retrieval system