KEGG   Bacillus subtilis subsp. subtilis 168: BSU31970
Entry
BSU31970          CDS       T00010                                 

Symbol
dhbB
Name
(RefSeq) isochorismatase
  KO
K01252  bifunctional isochorismate lyase / aryl carrier protein [EC:3.3.2.1 6.3.2.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01053  Biosynthesis of siderophore group nonribosomal peptides
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    BSU31970 (dhbB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU31970 (dhbB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.1  isochorismatase
     BSU31970 (dhbB)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     BSU31970 (dhbB)
Polyketide biosynthesis proteins [BR:bsu01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    BSU31970 (dhbB)
   Bacillibactin synthetase
    BSU31970 (dhbB)
  Nonlinear NRPS
   Vibriobactin synthetase
    BSU31970 (dhbB)
   Myxochelin synthetase
    BSU31970 (dhbB)
   Vanchrobactin synthetase
    BSU31970 (dhbB)
SSDB
Motif
Pfam: Isochorismatase PP-binding
Other DBs
NCBI-GeneID: 936582
NCBI-ProteinID: NP_391077
Pasteur: BG11241
BSORF: BG11241
UniProt: P45743 A0A6M4JP03
Position
complement(3287675..3288613)
AA seq 312 aa
MAIPAIQPYQMPTASDMPQNKVSWVPDPNRAVLLIHDMQNYFVDAFTAGASPVTELSANI
RKLKNQCVQLGIPVVYTAQPGSQNPDDRALLTDFWGPGLNSGPYEEKIITELAPEDDDLV
LTKWRYSAFKRTNLLEMMRKEGRDQLIITGIYAHIGCLVTACEAFMEDIKAFFVGDAVAD
FSLEKHQMALEYAAGRCAFTVMTDSLLDQLQNAPADVQKTSANTGKKNVFTCENIRKQIA
ELLQETPEDITDQEDLLDRGLDSVRIMTLVEQWRREGAEVTFVELAERPTIEEWQKLLTT
RSQQVLPNADYL
NT seq 939 nt   +upstreamnt  +downstreamnt
atggctatacctgccattcagccgtatcaaatgccgacagcatctgatatgccgcaaaac
aaagtatcatgggtgcctgatccgaatcgggctgtcttgttaatacacgatatgcaaaac
tattttgttgatgctttcacagcgggagcgtctccggtaacagagctttcagcgaatata
cgaaagctgaagaatcaatgtgttcagcttgggattcctgttgtctataccgcacagccg
ggaagccaaaatccggatgaccgtgcgctgctgacagacttttggggcccgggattaaac
agcggtccttatgaggagaaaattataaccgagctggcaccagaggatgatgatcttgtg
ctgacaaaatggagatacagcgcgtttaagagaacgaatctgcttgaaatgatgcgcaaa
gagggacgcgatcagctgatcattacaggaatttacgcccatatcggctgtcttgttaca
gcatgtgaagcatttatggaggatattaaagccttttttgtgggagatgcagttgctgat
ttttcattagaaaaacatcaaatggcgctggaatatgcggctggacgctgtgcgtttacc
gtgatgactgacagtcttcttgatcagctgcagaatgcgccggcagacgttcaaaaaacg
tcagcaaacactggcaaaaagaacgtgtttacatgtgagaatatccgtaaacaaattgct
gagcttctacaagaaacaccggaagacatcacagatcaagaggatttgctcgatcgtggt
cttgattcggtaaggatcatgacattggtggaacaatggcgccgtgaaggggcagaggtg
actttcgtggaattggctgaacgcccaacgatcgaagaatggcagaaattgctcacaact
cgcagccagcaagtgctgccaaacgcggattatttataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU31980
Entry
BSU31980          CDS       T00010                                 

Symbol
dhbE
Name
(RefSeq) 2,3-dihydroxybenzoate-AMP ligase
  KO
K02363  2,3-dihydroxybenzoate---[aryl-carrier protein] ligase [EC:6.3.2.14 6.2.1.71]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01053  Biosynthesis of siderophore group nonribosomal peptides
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    BSU31980 (dhbE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU31980 (dhbE)
Enzymes [BR:bsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.71  2,3-dihydroxybenzoate---[aryl-carrier protein] ligase
     BSU31980 (dhbE)
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     BSU31980 (dhbE)
Polyketide biosynthesis proteins [BR:bsu01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    BSU31980 (dhbE)
   Bacillibactin synthetase
    BSU31980 (dhbE)
  Nonlinear NRPS
   Vibriobactin synthetase
    BSU31980 (dhbE)
   Myxochelin synthetase
    BSU31980 (dhbE)
   Vanchrobactin synthetase
    BSU31980 (dhbE)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C SAP
Other DBs
NCBI-GeneID: 936509
NCBI-ProteinID: NP_391078
Pasteur: BG11020
BSORF: BG11020
UniProt: P40871 A0A6M3ZG89
Structure
PDB: 
1MDB 1MDF 1MD9

Position
complement(3288641..3290260)
AA seq 539 aa
MLKGFTPWPDELAETYRKNGCWAGETFGDLLRDRAAKYGDRIAITCGNTHWSYRELDTRA
DRLAAGFQKLGIQQMDRVVVQLPNIKEFFEVIFALFRLGALPVFALPSHRSSEITYFCEF
AEAAAYIIPDAYSGFDYRSLARQVQSKLPTLKNIIVAGEAEEFLPLEDLHAEPVKLPEVK
SSDVAFLQLSGGSTGLSKLIPRTHDDYIYSLKRSVEVCWLDHSTVYLAALPMAHNYPLSS
PGVLGVLYAGGRVVLSPSPSPDDAFPLIEREKVTITALVPPLAMVWMDAASSRRDDLSSL
QVLQVGGAKFSAEAARRVKAVFGCTLQQVFGMAEGLVNYTRLDDPEEIIVNTQGKPMSPY
DEMRVWDDHDRDVKPGETGHLLTRGPYTIRGYYKAEEHNAASFTEDGFYRTGDIVRLTRD
GYIVVEGRAKDQINRGGEKVAAEEVENHLLAHPAVHDAAMVSMPDQFLGERSCVFIIPRD
EAPKAAELKAFLRERGLAAYKIPDRVEFVESFPQTGVGKVSKKALREAISEKLLAGFKK
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgctgaaaggatttacgccttggcctgatgagttagctgagacctatcgaaagaacggc
tgctgggccggtgagacgtttggagatttgttaagggaccgggcagccaaatatggtgat
cgcattgccattacatgcggaaacacccattggagctatcgagagcttgacacaagggct
gatcgcctggctgccggatttcaaaagctcggcattcaacagatggatcgtgttgtggtg
cagttgccaaatatcaaagagttttttgaagtcattttcgcgcttttccgtctgggggcg
cttccagtcttcgcactgccttctcatcgaagcagtgaaattacatatttttgcgagttt
gctgaagcggctgcatatatcattcccgacgcttattccggttttgactaccgttcgctt
gccagacaggttcaaagcaagctgccgactttgaaaaacatcattgtcgcaggtgaggca
gaggaatttttaccgctggaggatttgcatgcagaacctgtaaaactgcctgaagtcaaa
tcatcggatgtggcgttcctccagctttctggcgggagcaccgggctatcgaaactgatt
ccgaggacccacgatgactacatatacagcctgaagcggagtgtggaggtctgctggctc
gaccacagcacggtgtacttggccgcgctgccgatggcacacaattatccgctgagctca
cccggcgttctcggcgtattatacgctggaggaagagtggtattatctccttctccaagt
ccagatgacgcatttcctttaattgaacgggaaaaggtcacgataaccgctcttgttccg
cctcttgcgatggtatggatggatgcggcatcctcacgccgtgatgatttatccagcctt
caagtgctgcaggtcggcggtgccaagtttagtgctgaagccgcgcgcagggtaaaagct
gttttcggctgcacgctgcagcaggtgttcggaatggcagagggtctcgtcaattatacg
agattggatgatcctgaggagatcattgtcaacacccaaggaaaaccgatgtctccatat
gatgaaatgcgtgtttgggatgatcatgatcgcgacgtaaaacctggtgaaacaggccat
ctgctgacgcgggggccgtatacaattcgaggttactataaggcagaagagcataacgcc
gcttcatttactgaggacggtttttaccgtacgggtgatatcgtcaggctgacacgagac
ggctatattgtcgttgaaggccgggcgaaggatcaaattaaccgtggaggagaaaaggtt
gcggctgaagaggtagaaaatcatctgctggcgcatccggctgtccatgatgcggcaatg
gtctccatgcctgatcaatttcttggcgaaagatcttgtgtgttcattattccccgggat
gaagccccaaaagccgcagagcttaaagcatttttgagagagcgcggactggcggcatat
aaaatccctgatcgagttgaatttgtcgaatccttcccgcagacaggagtaggaaaagtc
agcaaaaaagcgctccgtgaagccatttccgagaagcttcttgcaggatttaaaaaataa

DBGET integrated database retrieval system