KEGG   Bacillus subtilis subsp. subtilis 168: BSU32470
Entry
BSU32470          CDS       T00010                                 

Gene name
pucE
Definition
(RefSeq) xanthine dehydrogenase subunit E
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU32470 (pucE)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BSU32470 (pucE)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Thioredoxin_13
Other DBs
NCBI-GeneID: 936680
NCBI-ProteinID: NP_391127
Pasteur: BG13988
BSORF: BG13988
UniProt: O32143 A0A6M3ZG12
Position
complement(3335751..3336272)
AA seq 173 aa
MDIKEAGPFPVKKEQFRMTVNGQAWEVAAVPTTHLSDLLRKEFQLTGTKVSCGIGRCGAC
SILIDGKLANACMTMAYQADGHSITTIEGLQKEELDMCQTAFLEEGGFQCGYCTPGMIIA
LKALFRETPQPSDKDIEEGLAGNLCRCTGYGGIMRSACRIRRELNGGRRESGF
NT seq 522 nt   +upstreamnt  +downstreamnt
atggacataaaagaggccgggccatttcctgtaaaaaaggaacagttccggatgaccgtg
aatggtcaggcgtgggaggttgctgccgttcctacgacacatctgagtgacctgcttaga
aaggaatttcagctgaccgggacaaaggtgtcctgcggaatcggccgctgcggagcctgc
tctattttaatcgacggaaaactggccaatgcgtgcatgacgatggcctatcaagcagac
ggccattccatcacaaccatcgaggggcttcaaaaagaagagctggatatgtgtcaaacc
gctttcctggaagaaggcggcttccaatgcggctactgtacgccgggaatgatcattgcg
cttaaagcattgtttcgggaaacccctcaaccttctgacaaagatatagaagaagggctg
gcggggaatttgtgccggtgtaccgggtatggcgggattatgcggtcagcttgcaggatt
agaagagagttgaacgggggtagacgggagtccggcttttaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU32480
Entry
BSU32480          CDS       T00010                                 

Gene name
pucD
Definition
(RefSeq) xanthine dehydrogenase subunit D
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU32480 (pucD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BSU32480 (pucD)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-GeneID: 936686
NCBI-ProteinID: NP_391128
Pasteur: BG13989
BSORF: BG13989
UniProt: O32144 A0A6M3ZJ66
Position
complement(3336263..3338500)
AA seq 745 aa
MIINKPSRVRPDGRGKVTGELKYMTDLSFPGMLYGKVLRSAYPHAEIVSVCTIKAEKMEG
VQAVVTHKDVPGLNRFGIVIPDQPVLCEDRVRYVGDAIAAVAAETEEIAEAALELIQVEY
KELEVMDSPEKALRPNAQRLHEDGNILHRAFFSNGDVEEGFQASDTVFEETYELPRQMHT
YMETEGGVAVPEDDGGFTMYAGTQHGYKDRFQLARIFDIPEEKIRIVSSPMGGSFGGKDE
LNIQPYAALLALKSGRPVKIHQTRKESVRSGIKRHPMKITIKTGADHSGNLLAHDVKIVA
DTGAYATLGPAVLDFSVEHAAGPYRIPNIRTEGISVFTNNGVAGEFRGFGGNQITFALET
HLDRLSGMLGIDPLELRRKNIRKPHDLGPLEHRIAPTDGAAQVLNAISKSPILKKTSRNC
GYLQRGTGAAITMHGGGLGFGRMDAAGGRLSLSSEGKITASFGFEECGQGILAAIEQIVM
EELGCAAEDISIVIGDTAKVPKSGSSTASRGTSMVWHAIQRLKKPFLAQLKKRAAEWSGC
SAENLIPGAAGLRDKNTKALVVTYKELAEKGPLAEETAFDFPTTPDPVVGGHFLYSFGAA
AVEVEVDLLTGDVKLIDCEHAIAAGPVVSPQGYRGQIEGGAAMALGYTLMEEAKMTDGRY
AAENLDHYLIPGIKDVPDMKLIAIEDLMKGDVYGPRGVGEIGTIAITPAIVKAVHDAVGC
WINKLPISREELLEAIDRKGLKQWT
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgatcatcaacaaaccgtcaagagtcaggccggatggaaggggtaaggtcacaggggaa
ttgaaatatatgaccgatctcagctttccaggaatgctgtatggcaaggtgctgagaagt
gcttatcctcatgcagagattgtgtcggtttgcaccataaaagctgagaaaatggaaggc
gtgcaggccgtcgtcacacataaagacgttcccggcttaaaccgatttggcattgtcatc
cctgatcagccggttttatgtgaggacagggtgcggtatgtcggggatgcgatcgccgca
gttgctgcggaaacggaagaaatcgcggaagcggcgctggagctgattcaagttgagtat
aaagagctggaagtcatggattcaccagaaaaagcgcttcggccgaatgcgcaaagactg
catgaggacgggaatatcctgcaccgcgcatttttttcaaacggtgatgtggaagaaggg
tttcaagcatctgacacagtctttgaagaaacctatgagctgccgcggcagatgcatacg
tatatggaaacggagggaggtgtagccgttccggaagacgacgggggttttacgatgtat
gcaggaacccagcacggctataaagaccgtttccagcttgcccgtatttttgatattcct
gaagagaagatcagaattgtgtcaagtccgatgggcggctcgttcggagggaaggatgag
ctgaatattcagccgtatgctgcgcttttggccctgaaaagcggacgccctgtcaaaatt
catcagacacgaaaggaatctgtacgttctggcattaagcgccatccgatgaagattacg
ataaaaacgggtgcagatcattcgggaaatctattggcgcacgacgtgaaaattgtggcg
gacacaggcgcttacgctacgctcggaccggctgttcttgatttttctgtcgagcatgcc
gcggggccgtaccgtattccgaatatccggactgaaggaatatcagtatttacgaacaac
ggggtggcgggggaatttcggggctttggcggcaaccaaatcacatttgcactcgaaacc
catctcgatcgtctcagcggcatgcttggcatcgacccgctcgagctgagaagaaaaaat
atcagaaaaccgcatgacttggggccgcttgagcatcgaattgcaccaactgacggagcg
gcacaggtgttgaatgccatatctaaatctcccattcttaaaaaaacaagccggaactgc
gggtatctgcaaagaggcacgggagcggcaattacaatgcacggcggcgggctggggttt
ggccgaatggatgcggcaggaggccgtttgtctctttcgagtgaaggcaaaatcactgct
tcgtttggatttgaagaatgcggacaggggattctagcagcgattgaacagattgtcatg
gaggagctgggttgtgccgcagaggatatttccattgttattggggataccgcaaaagtg
ccgaagtcaggctcctccacagcatcccgcggcacaagcatggtgtggcacgcgatccag
cgtttgaagaagccgtttctagctcagttgaaaaaacgggcggcagaatggagcggctgt
tcagcggaaaatcttattcccggcgctgcaggcttgcgtgacaaaaacacaaaggcgctc
gtggtgacgtataaggagctggctgaaaaaggccctttggcagaggaaacggcctttgac
tttccaacaacgcctgatcctgtggtgggcggccatttcctctactcatttggagcggct
gccgttgaggtggaggtagatctgttaacaggcgatgtcaaattgatagattgtgagcac
gctattgcggcaggtccggttgtcagtccgcagggatatcgaggtcaaattgaaggcggc
gctgccatggcactcggctacacactgatggaggaagcgaaaatgacggatggccgttat
gctgcggaaaatctcgatcactatttgattcccggaatcaaagatgttcctgacatgaag
ctgattgcaatagaagacttaatgaagggagacgtatatggaccgcgcggtgttggtgaa
atcggaacaatcgccatcactccggcgattgtaaaggcagtacatgatgcggtcggatgc
tggataaacaagctgccaatttcaagagaagagttgcttgaagcgatcgacagaaagggg
ctgaagcaatggacataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU32490
Entry
BSU32490          CDS       T00010                                 

Gene name
pucC
Definition
(RefSeq) xanthine dehydrogenase subunit C
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU32490 (pucC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BSU32490 (pucC)
SSDB
Motif
Pfam: FAD_binding_5 CO_deh_flav_C
Other DBs
NCBI-GeneID: 936685
NCBI-ProteinID: NP_391129
Pasteur: BG13990
BSORF: BG13990
UniProt: O32145 A0A6M3ZGC4
Position
complement(3338501..3339334)
AA seq 277 aa
MNGQVTKARMNIQLWRPAALDEAYSLLEKLAPDVCAASGSTLLQLQWDKGTLPKQHLVSL
EGIDEMRGISTSDTHVSIGGLTSLNECRKNPLIKRALSCFSDAASAVAAPGIRSRATIGG
NIASKIGDFIPLLLVLGAELIVYQKELIRLPLGAWLSEEDFRTAIVTRVIIPRAEGERVF
YHKLGRRQAFTGAAAVAAGRFLKDGSIRLAAGHADITPRRLLDSEAKWMAPGWDPHELYK
TLIHELPFSSDVFMSAAYRKKAAANVIMAELMAEGGE
NT seq 834 nt   +upstreamnt  +downstreamnt
ttgaacggccaagtgacaaaagcaaggatgaatattcaattatggagaccggcagcgctt
gatgaggcctattcgcttttagagaagcttgctccggatgtgtgtgccgcatcgggaagc
acgctccttcagcttcagtgggacaaaggaactctaccgaaacagcaccttgtcagcctt
gaagggattgacgaaatgcgagggatcagcaccagtgacacccacgtgtcgatcgggggg
ctcacatcactgaatgaatgcagaaagaaccctttgattaagagagcgcttagctgtttc
agtgacgctgcttccgctgtcgctgcaccggggattcgcagccgtgccacgattggcggc
aacatagcgagtaaaatcggtgatttcattccgcttctgcttgtgcttggtgctgagctt
atcgtatatcaaaaggagctaatcaggctgccgcttggcgcttggctcagtgaggaagac
tttagaacggctatcgtcacgcgtgtcatcatcccgcgggcggagggagagcgtgtattt
tatcacaagcttggaaggcgccaggcttttaccggagcggctgctgttgcagctggacgt
tttttgaaagacggcagcattcgcctcgccgctggccatgccgatatcactcctaggaga
ttattggacagcgaagcgaaatggatggcaccagggtgggacccgcatgagctgtacaaa
acacttatccatgagctgccgttttcctcagatgtttttatgtcagcggcatacagaaaa
aaagccgctgccaacgtcatcatggcagagctgatggctgagggaggggaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU32500
Entry
BSU32500          CDS       T00010                                 

Gene name
pucB
Definition
(RefSeq) purine catabolism protein PucB
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU32500 (pucB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BSU32500 (pucB)
SSDB
Motif
Pfam: NTP_transf_3 IspD
Other DBs
NCBI-GeneID: 936486
NCBI-ProteinID: NP_391130
Pasteur: BG13991
BSORF: BG13991
UniProt: O32146 A0A6M4JP08
Position
complement(3339331..3339948)
AA seq 205 aa
MRSPYLIGVFLAAGKSRRMGQNKLALPLKGENIGSLSLKTALSSRLDHVLVVERTEHASL
EWIGAPYHAPPFQKRWSLHVCQDAEKGQGHSVSSGVRKAESMGADGIVILLADQPQLSVD
HLNALVALAPESFAVSSFLGAFTPPIYFSSTCFPYVKGLKGDEGARRLLKSGQLGAGAVL
EAKDSGELDDIDTPEEYDMVRRAMS
NT seq 618 nt   +upstreamnt  +downstreamnt
atgagaagcccctatctgatcggcgtgtttctcgctgccggcaaaagcagaagaatggga
caaaacaagctggctttgccgctaaaaggagaaaacataggctcactttccttgaaaact
gctctgtcgtcccgccttgatcacgtgctggtcgtcgagcggacagaacatgcctccctt
gagtggataggagcgccgtatcacgctccgccttttcaaaaacgctggagcctgcacgtt
tgccaagacgcagaaaagggtcaggggcattcagtcagcagcggggtgagaaaagcagaa
agcatgggggcggacggcattgtcattttgttagccgaccagcctcagctttccgtcgat
catctcaatgcccttgtggctctggctcctgagtcatttgccgtgtcatcgtttttaggg
gcgttcaccccgccaatctacttctcgtcgacatgttttccttatgtaaagggattaaag
ggagatgaaggggctcgcaggctcctgaaaagcggacagcttggagcaggagcggttttg
gaggcaaaggatagcggtgagttggacgatattgatacacccgaggaatatgacatggta
aggagggcgatgtcttga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU32510
Entry
BSU32510          CDS       T00010                                 

Gene name
pucA
Definition
(RefSeq) xanthine dehydrogenase subunit A
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU32510 (pucA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BSU32510 (pucA)
SSDB
Motif
Pfam: XdhC_C XdhC_CoxI
Other DBs
NCBI-GeneID: 938865
NCBI-ProteinID: NP_391131
Pasteur: BG13992
BSORF: BG13992
UniProt: O32147 A0A6M3ZGL3
Position
complement(3339945..3340937)
AA seq 330 aa
MGNFHTMLDALLEDQEEAVLATIVQVEGSAYRKAGASMLFKKKGRRIGLLSGGCVEEDVF
QRISALGDQLTSTLIPYDMRSEDDLSWGMGAGCNGIIHVHAERITQEKRRHYEKVRDCLH
SGKAVTSVIKIESSHYLFLTENGHFGNWPDAPLQDIQRTVSTLHLPHFDQTTNMFIQRIE
PKPRLILFGAGPDNVPLANLAADTGFSVIVTDWRPAYCTSSLFPKADQLITAFPEQMLSE
FQFFPHDAAVVATHHYQHDQTIINFLFSQNLHYIGLLGSANRTKRLLSGKHPPSHFYSPV
GLKIGAEGPEEIAVSVVAEIIQTRKRVAVV
NT seq 993 nt   +upstreamnt  +downstreamnt
ttggggaattttcacacgatgttagatgcgctcctggaagaccaggaggaggctgtactg
gcgacaattgttcaagttgaaggctccgcgtatcgaaaagcaggcgcctctatgctcttt
aagaaaaaaggcagacggattggcttgctgagcggcgggtgtgtggaagaagatgtattc
caaagaatcagtgcgctgggcgatcagctcacatcaacgctgattccctacgacatgcgg
tcggaggacgatctttcttggggcatgggagccgggtgcaatggcattattcatgttcat
gcagagcgaatcactcaggaaaaaaggcggcactatgagaaagtgagggactgccttcat
tcaggcaaagctgtcacttccgttataaagattgaatcctcccattatttatttctgacg
gagaacggacattttgggaactggccggacgcgcctctgcaagatattcaacgtactgtt
tcaacgcttcatttaccgcatttcgatcaaaccactaacatgtttattcagcgaattgaa
ccgaagccgcgtctcattctgtttggggcgggaccggataatgtaccgctggccaatttg
gcggctgacacagggttttctgttatcgtgacggattggcggcccgcttattgtacatcc
tctctttttccaaaagcggatcagctgatcaccgcttttccggaacaaatgcttagcgaa
tttcaattttttccgcatgatgcagctgttgtggcaacccatcattatcagcacgatcaa
acgatcatcaacttcttattttctcaaaacctccattatattggactgttgggttcggca
aaccgcacgaaacggctgctgagcggaaaacatcctccgtctcacttttacagtccggtc
gggctgaaaatcggtgcggaaggtcccgaggaaattgcggtaagtgtagttgcagaaatc
attcaaacaagaaaacgggtggcggttgtatga

DBGET integrated database retrieval system