KEGG   Bacillus subtilis subsp. subtilis 168: BSU33610
Entry
BSU33610          CDS       T00010                                 

Symbol
rnr
Name
(RefSeq) ribonuclease R
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU33610 (rnr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU33610 (rnr)
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU33610 (rnr)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     BSU33610 (rnr)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     BSU33610 (rnr)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  tRNA degradation factors
   BSU33610 (rnr)
SSDB
Motif
Pfam: RNB CSD2 OB_RNB S1 TFIIE_beta
Other DBs
NCBI-GeneID: 938644
NCBI-ProteinID: NP_391241
Pasteur: BG14065
BSORF: BG14065
UniProt: O32231 A0A6M3ZKU9
Position
complement(3451863..3454202)
AA seq 779 aa
MEKEAFMEKLLSFMKEEAYKPLTVQELEEMLNITEAEEFKELVKALVALEEKGLIVRTRS
DRYGIPEKMNLIKGKISAHAKGFAFLLPEDTSLSDVFIPPNELNTAMNGDIVMVRLNSQS
SGSRQEGTVIRILERAIQRVVGTYTETRNFGFVIPDDKKITSDIFIPKNGKNGAAEGHKV
VVKLTSYPEGRMNAEGEVETILGHKNDPGIDILSVIHKHGLPGEFPADAMEQASSTPDTI
DEKDLKDRRDLRDQVIVTIDGADAKDLDDAVTVTKLDDGSYKLGVHIADVSHYVTENSPI
DKEALERGTSVYLVDRVIPMIPHRLSNGICSLNPKVDRLTLSCEMTINSQGQVTEHEIFQ
SVIKTTERMTYSDVNKILVDDDEELKQKYEPLVPMFKDMERLAQILRDKRMDRGAVDFDF
KEAKVLVDDEGAVKDVVIRERSVAEKLIEEFMLVANETVAEHFHWMNVPFIYRIHEEPNA
EKLQKFLEFVTTFGYVVKGTAGNIHPRALQSILDAVRDRPEETVISTVMLRSMKQAKYDP
QSLGHFGLSTEFYTHFTSPIRRYPDLIVHRLIRTYLINGKVDEATQEKWAERLPDIAEHT
SSMERRAVDAERETDDLKKAEYMLDKIGEEFDGMISSVTNFGMFVELPNTIEGLVHVSFM
TDDYYRFDEQHFAMIGERTGNVFRIGDEITVKVVDVNKDERNIDFEIVGMKGTPRRPREL
DSSRSRKRGKPARKRVQSTNTPVSPAPSEEKGEWFTKPKKKKKKRGFQNAPKQKRKKKK
NT seq 2340 nt   +upstreamnt  +downstreamnt
atggaaaaagaagcatttatggaaaagcttctctcgtttatgaaggaagaggcgtacaaa
cctctgaccgttcaggaacttgaggagatgttaaatattacggaagccgaggagtttaaa
gagctcgtcaaagcgttagtcgccttggaagaaaaagggcttatcgtacggacgagaagc
gaccgctacggcattccggagaagatgaatttaataaaaggaaagatttcagcccatgcg
aaaggattcgcctttttgctgcctgaggatacgtcgttaagtgatgtgtttattccgcct
aatgagctaaatacggcaatgaacggcgatatcgtcatggtgcgtctgaactcacaatca
agcggctccaggcaggaaggaaccgtcatacggattttagaaagagcgattcagcgggtt
gtcggcacgtatacagaaacgagaaacttcggctttgtcattccggacgacaaaaaaatc
acgagtgacatcttcattccgaaaaatgggaaaaatggagctgcggaagggcataaggtt
gttgtcaagctgacgagctatcctgaaggccgcatgaacgcagagggtgaggttgaaacc
attctcggccacaaaaacgacccgggcattgatattttatcggtcattcataagcacggc
ctgccgggagaatttccagctgacgcgatggaacaggcatcaagtacgcctgacacgatt
gatgaaaaagatctgaaagaccgccgtgatctccgtgaccaggtgattgtcaccattgat
ggtgcggatgcgaaggatttggatgatgcagttaccgtgacgaagcttgatgatggaagc
tacaagcttggcgttcacatagctgatgtcagccattacgtaaccgaaaactcgccgatt
gacaaagaagcgcttgaaagagggacaagtgtgtatctggttgaccgtgtcatcccgatg
attccgcacagattgtcaaacggcatctgctccttaaatccaaaggttgaccgcctgacg
ctttcttgtgaaatgacaattaacagtcagggacaggtgacagagcacgagatcttccaa
agtgtcatcaaaacaacggaaagaatgacatattcagatgtgaataaaattcttgttgat
gatgatgaagagctgaaacaaaaatacgagcctcttgttccgatgttcaaagacatggag
cgtctggctcaaattctgcgcgataagcggatggaccgcggcgccgttgactttgatttc
aaagaagcaaaggtgcttgttgatgacgaaggagcggttaaagacgttgtgatcagagaa
cgctctgtcgccgagaagctgattgaagaatttatgcttgtagcaaacgaaacagttgcg
gagcatttccattggatgaatgtcccgtttatataccggattcacgaagagccgaatgct
gaaaagctgcaaaagtttttagaatttgtgacgacatttggctatgtggtgaaaggaacg
gcggggaatattcatccgcgcgcgctgcaaagcattctggacgctgtgcgtgacagacca
gaggaaacggttatatctactgttatgctccgttcgatgaaacaggcgaaatacgacccg
caaagcttggggcacttcggtctgtcaacggaattctatacgcatttcacatcaccgatc
cgccgttacccggacttaatcgttcaccgtctgatccgaacgtatttgatcaacggcaag
gtcgatgaagcgacacaggaaaagtgggctgaacgcctgccggatatcgccgaacataca
tcatctatggagcgccgtgcagttgacgccgagcgtgagacggatgatctgaaaaaagcg
gaatacatgcttgataaaatcggtgaagagtttgacggcatgatcagctctgtgacaaac
ttcggaatgttcgtcgagctgccgaatacaattgaaggactcgtccatgtcagctttatg
acagatgactactaccgctttgacgaacagcatttcgcaatgattggcgagcggacaggc
aacgtcttccgcatcggggatgaaatcacagtcaaggttgtcgatgtcaataaagatgag
cgcaatatcgactttgaaattgtcggcatgaaaggcactccgcggcgtccgagagaattg
gacagcagccggagcagaaaacgcggaaagcctgccagaaaacgtgttcaaagcaccaat
acacctgtttctccagctccgtctgaggaaaaaggggagtggttcactaagccgaagaag
aaaaagaaaaaacgcggcttccagaatgctccgaaacagaaacggaaaaagaagaaatag

DBGET integrated database retrieval system