KEGG   Bacillus subtilis subsp. subtilis 168: BSU33630
Entry
BSU33630          CDS       T00010                                 

Gene name
secG
Definition
(RefSeq) protein-export membrane protein SecG
  KO
K03075  preprotein translocase subunit SecG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
bsu03060  Protein export
bsu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU33630 (secG)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSU33630 (secG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU33630 (secG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU33630 (secG)
Secretion system [BR:bsu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BSU33630 (secG)
SSDB
Motif
Pfam: SecG DUF3852 ODV-E18 DUF3671
Other DBs
NCBI-GeneID: 938477
NCBI-ProteinID: NP_391243
Pasteur: BG14067
BSORF: BG14067
UniProt: O32233 A0A6M4JP81
Position
complement(3455093..3455323)
AA seq 76 aa
MHAVLITLLVIVSIALIIVVLLQSSKSAGLSGAISGGAEQLFGKQKARGLDLILHRITVV
LAVLFFVLTIALAYIL
NT seq 231 nt   +upstreamnt  +downstreamnt
atgcacgcagttttgattaccttattggttatcgtcagcattgcacttattattgtcgtt
ttgcttcaatccagtaaaagtgccggattatctggtgcgatttcaggcggagcggagcag
ctcttcgggaaacaaaaagcaagaggtcttgatttaattttgcaccgcattacggtagtg
ctggcagtcttgtttttcgtgttaacgattgcgcttgcttatatcctatag

DBGET integrated database retrieval system