KEGG   Bacillus subtilis subsp. subtilis 168: BSU34460
Entry
BSU34460          CDS       T00010                                 

Symbol
levB
Name
(RefSeq) levanbiose-producing levanase
  KO
K01212  levanase [EC:3.2.1.65]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU34460 (levB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.65  levanase
     BSU34460 (levB)
SSDB
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Other DBs
NCBI-GeneID: 938616
NCBI-ProteinID: NP_391326
Pasteur: BG12430
BSORF: BG12430
UniProt: O07003 A0A6M4JPE5
Position
3537507..3539057
AA seq 516 aa
MNYIKAGKWLTVFLTFLGILLFIDLFPKEEHDQKTKSKQKPDYRAAYHFTTPDKWKNDPQ
KPIYFDGKYHYFYLYNRDYPKGNGTEWRHAVSEDLVHWTDEGVAIPKYTNPDGDIWTGSV
VVDKENTAGFGKNALVAIVTQPSAKDKKQEQYLWYSTDKGKSFKFYSGNPVMPNPGTDDF
RDPKVIWDDQDNKWVMVMAEGSKIGFYESDNLKDWHYTSGFFPEQAGMVECPDLYMMRAS
DGTNKWVLGASANGKPWGKPNTYAYWTGSFDGKEFKADQTEAQWLDYGFDWYGGVTFEDS
KSTDPLEKRYALAWMNNWDYANNTPTMKNGFNGTDSVIRELRLKEQDGTYSLVSQPIEAL
EQLTVSTDEIEDQDVNGSKTLSITGDTYQLDTDLSWSELKNAGVRLRESEDQKRHIDVGI
FAEGGYAYVNRAATNQPDKSNTYVESKAPYDVNKRKVHLKILVDKTTIEVFVGDGKTVFS
NEVFPKPEDKGITLYSDGGTASFKNITVKHFDSIHE
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgaactatataaaagcaggcaaatggctaaccgtattcctaacctttttaggaatattg
ctgtttatcgacttatttccaaaagaagaacatgaccaaaaaacaaaatcaaaacagaag
ccggactaccgggcggcatatcattttacgacgccggataaatggaaaaatgaccctcaa
aaaccgatctattttgatggcaagtatcattatttctatctatataaccgggattaccca
aaaggcaacggcacagaatggcgccatgccgtctcagaggatttggtgcactggaccgat
gaaggcgtggcgattccgaaatatacaaacccggacggtgatatttggaccggttccgtc
gtggtggataaagagaacacagccggcttcgggaaaaatgcgcttgtcgcgattgtgaca
cagccctcagccaaagacaaaaaacaggaacaatatttgtggtacagcacagataaggga
aaatcattcaaattctacagtggcaaccccgttatgcctaatccgggcacagacgatttc
agagatccgaaagtcatatgggatgaccaagataacaaatgggtcatggtcatggctgaa
ggatcaaaaatcggcttttatgaatccgataatcttaaggactggcattacacaagcgga
ttcttcccagaacaggcgggaatggtggaatgtcccgacctctacatgatgcgggcaagc
gacggaacgaataagtgggttctcggtgccagcgcgaatggcaaaccgtggggcaaacca
aatacgtacgcctactggaccggaagcttcgacggaaaagaattcaaagcggatcagact
gaagcccaatggcttgactatggcttcgactggtatggcggtgtgacgttcgaagacagc
aaaagcacagatccattagaaaagcggtatgcgcttgcctggatgaacaattgggattat
gccaacaacaccccgacaatgaagaacggctttaacggcacagattctgtcatacgcgaa
ctccggctgaaggagcaggatggaacatacagcctcgtctcacagccgattgaagctttg
gagcagctgactgtttcaactgacgaaatagaggatcaggatgtgaacggatcaaaaaca
ttgtcgataacaggtgatacgtaccagcttgatacggatctttcttggtcagagctaaag
aatgcaggcgtcaggctcagagaatcagaagaccaaaaacgccatattgatgtcggcatt
ttcgctgaaggcggctatgcttatgtcaatagagcagccacaaatcagcctgacaaaagc
aatacctatgtcgaaagcaaagctccttatgatgtaaacaaacgtaaggtgcatttgaaa
atacttgtcgataaaacaacgatagaagtatttgttggcgacgggaaaaccgttttttca
aatgaagtcttcccaaagcctgaagataaaggaattaccctttattctgacggcggcaca
gcctccttcaaaaatataacagtgaaacactttgattcgattcatgaataa

DBGET integrated database retrieval system