KEGG   Bacillus subtilis subsp. subtilis 168: BSU34820
Entry
BSU34820          CDS       T00010                                 

Symbol
bmrA
Name
(RefSeq) multidrug resistance ABC transporter ATP-binding/permease protein BmrA
  KO
K18104  ATP-binding cassette, subfamily B, bacterial AbcA/BmrA [EC:7.6.2.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01501  beta-Lactam resistance
bsu02010  ABC transporters
Module
bsu_M00700  Multidrug resistance, efflux pump AbcA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU34820 (bmrA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BSU34820 (bmrA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34820 (bmrA)
   01504 Antimicrobial resistance genes [BR:bsu01504]
    BSU34820 (bmrA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     BSU34820 (bmrA)
Transporters [BR:bsu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BSU34820 (bmrA)
Antimicrobial resistance genes [BR:bsu01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AbcA [MD:M00700]
    BSU34820 (bmrA)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_21 AAA_22 ABC_membrane_2 AAA_29 AAA_30 RsgA_GTPase AAA_23 AAA_16 SbcC_Walker_B AAA_28
Other DBs
NCBI-GeneID: 936559
NCBI-ProteinID: NP_391362
Pasteur: BG12395
BSORF: BG12395
UniProt: O06967 A0A6M3ZGX4
Structure
Position
complement(3577745..3579514)
AA seq 589 aa
MPTKKQKSKSKLKPFFALVRRTNPSYGKLAFALALSVVTTLVSLLIPLLTKQLVDGFSMS
NLSGTQIGLIALVFFVQAGLSAYATYALNYNGQKIISGLRELLWKKLIKLPVSYFDTNAS
GETVSRVTNDTMVVKELITTHISGFITGIISVIGSLTILFIMNWKLTLLVLVVVPLAALI
LVPIGRKMFSISRETQDETARFTGLLNQILPEIRLVKASNAEDVEYGRGKMGISSLFKLG
VREAKVQSLVGPLISLVLMAALVAVIGYGGMQVSSGELTAGALVAFILYLFQIIMPMGQI
TTFFTQLQKSIGATERMIEILAEEEEDTVTGKQIENAHLPIQLDRVSFGYKPDQLILKEV
SAVIEAGKVTAIVGPSGGGKTTLFKLLERFYSPTAGTIRLGDEPVDTYSLESWREHIGYV
SQESPLMSGTIRENICYGLERDVTDAEIEKAAEMAYALNFIKELPNQFDTEVGERGIMLS
GGQRQRIAIARALLRNPSILMLDEATSSLDSQSEKSVQQALEVLMEGRTTIVIAHRLSTV
VDADQLLFVEKGEITGRGTHHELMASHGLYRDFAEQQLKMNADLENKAG
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgccaaccaagaaacaaaaatctaaaagtaaattgaaacccttttttgccttagtaaga
cggaccaatccttcttatggaaagctcgcctttgcgcttgccctcagtgtagtaaccacg
ctggtcagcctgctcattccattattaacgaagcagcttgtcgatggtttttctatgtca
aatctgtcaggcacgcaaatcggtttgatcgcgctggtgtttttcgttcaggcgggttta
agcgcttatgccacctatgcgcttaactataatggacaaaaaatcatttccgggctgcgg
gagttattatggaagaaattaattaagctgcctgtctcttatttcgatacaaatgcttcc
ggagaaacagtcagccgtgtaacgaacgatacgatggtggtcaaagaattgattacaacc
catatcagcggatttattacaggcatcatttctgtcattggatcattgacaatcttgttt
attatgaactggaagctgacactgcttgtgttagtggtcgttccgctggccgctcttatt
ttggtgccgattggacggaaaatgttctccatttcacgggaaacgcaagatgaaacggct
cgttttacaggcctgcttaatcaaattctcccggaaatcagacttgttaaggcttcaaat
gcggaggatgtcgaatatgggcgcgggaagatggggatttcctcattatttaagcttggc
gttcgtgaagccaaggttcaatcgcttgtcggcccgcttatttcactcgtgttaatggca
gcgcttgtcgcagtgatcggatatggcggcatgcaggtctcatcaggcgagctcacagcc
ggagcgctcgtggcttttattttatatttgtttcaaattattatgccgatgggccagatt
acaacgtttttcacacagctgcaaaaatcaatcggtgcaacagaacgaatgattgagatt
ttggcagaggaagaggaagatacagtgacaggaaaacaaattgaaaatgcacatctgcct
atccagcttgatcgcgtgtcttttggatataagcctgatcagctgatcttaaaagaggtc
agcgccgtcattgaagcagggaaagtgacagcgatcgtcggtccgagcggcgggggaaaa
acgacgctgtttaagctgcttgaacgcttttattctccgactgcagggaccattcggctg
ggggacgagccggtcgatacttactcgcttgaatcgtggagggagcatatcgggtatgta
tcacaggaaagcccgttaatgtccgggacaatcagagaaaatatttgctacgggttagaa
cgagatgtgacggatgctgagatcgaaaaagccgcggagatggcatatgcgctcaatttt
ataaaggagctgccgaatcagtttgatacagaagtgggcgaacgcggcattatgctgtca
ggcggacaaaggcaaagaatcgcgattgcgagagcgcttctccgtaacccaagcattctt
atgctcgatgaagctacctcaagtctcgacagccaatctgaaaaatcagttcagcaggcg
ctggaggtgctgatggagggccgcacaacgattgttatcgctcaccgcctatctaccgtt
gtagatgcggaccagcttttgtttgttgaaaaaggggaaattaccggtcgtggaacacac
catgagttaatggcttcccatggcctttaccgggattttgctgaacagcagctgaaaatg
aatgcggacttagaaaacaaagccgggtaa

DBGET integrated database retrieval system