KEGG   Bacillus subtilis subsp. subtilis 168: BSU34970
Entry
BSU34970          CDS       T00010                                 
Symbol
hprP
Name
(RefSeq) pyrophosphatase PpaX
  KO
K06019  pyrophosphatase PpaX [EC:3.6.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU34970 (hprP)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     BSU34970 (hprP)
SSDB
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Phage_Mu_Gp36 Hydrolase_3
Other DBs
NCBI-GeneID: 936613
NCBI-ProteinID: NP_391377
Pasteur: BG14127
UniProt: Q9JMQ2 A0A6M4JPJ5
Position
complement(3591810..3592460)
AA seq 216 aa
MSDKQVTTILFDLDGTLINTNELIIASFLHTLEHYYPSKYKREDVLAFIGPSLFDTFSSM
DPDKCEDMIAMYRAYNHDMHDSLVTEYETVYETLDALKKAGFTLGIVTTKLRDTVNMGLK
LTGIGEFFETVVTLDDVTNAKPDPEPVLLALKQLGSEPAEAIMVGDNYHDVLAGKNAGTK
TAGVAWTIKGPEMLAKHEPDFMLEKMSDLLQIVGVK
NT seq 651 nt   +upstreamnt  +downstreamnt
atgagtgacaaacaagtaacgacgattctgtttgatttagacggaacgcttattaatacg
aatgaattaattatcgcgtcctttttgcatacactggagcattattatccgagcaagtat
aaacgagaagatgtccttgcatttatcgggccgtctctttttgatacgttctcttcgatg
gaccctgataaatgcgaggatatgatcgctatgtacagagcgtacaatcatgacatgcat
gattcactcgtcactgaatatgaaacggtatatgagaccctggatgcattaaaaaaagcc
ggctttacattaggaattgtgacaacaaaattaagagatactgtcaatatgggcctcaag
ctcacgggaatcggcgaattctttgaaacagttgtcacccttgatgatgtgacgaatgca
aagcctgatcccgagcctgtgctgttagcgctgaaacagctaggaagcgagccggcggaa
gccattatggtcggtgataattaccatgatgtgctggcagggaaaaacgccggtacaaaa
acggcaggagtcgcatggacgattaaagggccggaaatgctggcgaagcatgagccggat
tttatgcttgagaaaatgagtgatctattacaaatcgttggagtgaagtaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU40550
Entry
BSU40550          CDS       T00010                                 
Symbol
ppaC
Name
(RefSeq) manganese-dependent inorganic pyrophosphatase
  KO
K15986  manganese-dependent inorganic pyrophosphatase [EC:3.6.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU40550 (ppaC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     BSU40550 (ppaC)
SSDB
Motif
Pfam: DHH DHHA2
Other DBs
NCBI-GeneID: 937817
NCBI-ProteinID: NP_391935
Pasteur: BG10014
UniProt: P37487 A0A6M4JR90
Structure
Position
4168204..4169133
AA seq 309 aa
MEKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRL
VETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPVGCTA
TILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEY
GLNMLKAGADLSKKTVEELISLDAKEFTLGSKKVEIAQVNTVDIEDVKKRQAELEAVISK
VVAEKNLDLFLLVITDILENDSLALAIGNEAAKVEKAFNVTLENNTALLKGVVSRKKQVV
PVLTDAMAE
NT seq 930 nt   +upstreamnt  +downstreamnt
atggaaaagatacttattttcggacaccaaaacccagatacagatacgatttgttctgcg
attgcttatgctgatttgaaaaacaaactcggcttcaatgctgagcctgtccgcctcgga
caagtcaacggcgaaacacaatacgcgcttgactatttcaaacaagaaagcccgcgtctt
gttgaaacagctgcaaacgaagtaaacggcgttatcctggttgaccataacgaacgccag
caaagcatcaaagacattgaagaggttcaggttttagaggttatcgaccatcaccgcatc
gctaactttgaaacagctgagccgctttactatcgtgctgagcctgtaggctgtacggct
accatcttaaacaaaatgtacaaagagaataacgtgaaaatcgagaaagaaattgccggc
cttatgctgtctgcgatcatttctgattccctgttatttaaatctccaacttgcacggac
caagacgtagcagcagcaaaagagcttgcggagatcgctggagtagatgctgaagaatac
ggcttgaacatgttgaaagcaggcgctgatctaagcaaaaaaacagtggaagagctcatt
tctcttgatgcgaaagaatttacactcggcagcaagaaagtcgaaatcgcacaagtaaac
acagtggacattgaagatgtaaaaaaacgccaagctgaattagaagctgtgatctcaaaa
gttgtggctgagaagaatcttgatctgttccttctcgttatcacagatatcttagaaaat
gattcacttgctcttgcaatcggtaacgaagcagcgaaagtggaaaaagcgttcaacgtt
acattagaaaacaacacagccctcttaaaaggcgttgtttcccgtaaaaaacaagtcgtt
cctgtcttaacagacgcaatggctgaataa

DBGET integrated database retrieval system