KEGG   Bacillus subtilis subsp. subtilis 168: BSU35320
Entry
BSU35320          CDS       T00010                                 

Symbol
fliT
Name
(RefSeq) flagellar protein FliT
  KO
K02423  flagellar protein FliT
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU35320 (fliT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU35320 (fliT)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Filament
    BSU35320 (fliT)
SSDB
Motif
Pfam: HEPN_Swt1 CAAP1 FliT
Other DBs
NCBI-GeneID: 936718
NCBI-ProteinID: NP_391412
Pasteur: BG10923
BSORF: BG10923
UniProt: P39740 A0A6M3ZL45
Position
complement(3632150..3632491)
AA seq 113 aa
MNNIDQLYTETKSMLSHIQNTPESDELLKQIEDFVATRSELIQEISLPLSEEERKQMKLI
LTWDQLIVKEMERLKQSIATELQQMKRKRVMHTTYLNPYNNITIDGTYYDKRK
NT seq 342 nt   +upstreamnt  +downstreamnt
atgaataatatagatcaactatacactgagacgaagagtatgctgtcacacatacaaaat
acgccggaaagcgatgaacttttaaagcaaattgaagactttgtggctacacggtctgaa
ctgattcaggagatatctctgccgctttcagaagaagagcgaaagcagatgaaacttatt
ttgacatgggatcagctgattgtgaaggaaatggaaagactgaagcagtcaatcgcaaca
gaacttcagcagatgaaaagaaaacgtgtgatgcatacgacgtatttaaacccttataac
aacattacgattgacggcacatattatgacaagcgtaaatag

DBGET integrated database retrieval system