KEGG   Bacillus subtilis subsp. subtilis 168: BSU35330
Entry
BSU35330          CDS       T00010                                 

Symbol
fliS
Name
(RefSeq) flagellar protein FliS
  KO
K02422  flagellar secretion chaperone FliS
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU35330 (fliS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU35330 (fliS)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Filament
    BSU35330 (fliS)
SSDB
Motif
Pfam: FliS
Other DBs
NCBI-GeneID: 936720
NCBI-ProteinID: NP_391413
Pasteur: BG10922
BSORF: BG10922
UniProt: P39739 A0A6M4JPP3
Structure
PDB: 
5MAW 6GOW 1VH6

Position
complement(3632488..3632889)
AA seq 133 aa
MAIQNPYTAYQQNSVNTATPGELTLMLYNGCLKFIRLAAQAIENDDMERKNENLIKAQNI
IQELNFTLNRNIELSASMGAMYDYMYRRLVQANIKNDTGMLAEVEGYVTDFRDAWKQAIQ
SERKDRHGSGGIA
NT seq 402 nt   +upstreamnt  +downstreamnt
atggcgatccaaaatccatatacagcctatcagcaaaattcagtgaatacggctacaccc
ggggagctgacgcttatgctgtataatggctgtttgaaatttataagacttgccgctcag
gccattgagaatgatgatatggaacgtaaaaatgaaaatctgattaaagcgcaaaatatt
attcaggaattaaattttacacttaaccgtaacatagagctttccgcttctatgggtgcg
atgtacgattatatgtatcgcagattggtacaggcaaatatcaaaaatgatacgggcatg
ctggctgaggttgaaggttatgtaacagattttcgcgatgcttggaaacaagccattcaa
agtgagcggaaggaccggcacggatcaggcgggatcgcatga

DBGET integrated database retrieval system