KEGG   Bacillus subtilis subsp. subtilis 168: BSU35660
Entry
BSU35660          CDS       T00010                                 

Symbol
mnaA
Name
(RefSeq) UDP-N-acetylglucosamine 2-epimerase
  KO
K01791  UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing) [EC:5.1.3.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu00541  O-Antigen nucleotide sugar biosynthesis
bsu01100  Metabolic pathways
bsu01250  Biosynthesis of nucleotide sugars
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU35660 (mnaA)
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BSU35660 (mnaA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU35660 (mnaA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.14  UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing)
     BSU35660 (mnaA)
SSDB
Motif
Pfam: Epimerase_2 Glyco_trans_4_2 Glyco_transf_4
Other DBs
NCBI-GeneID: 936209
NCBI-ProteinID: NP_391446
Pasteur: BG10403
BSORF: BG10403
UniProt: P39131 A0A6M4JPS3
Structure
PDB: 
4FKZ 1O6C

Position
complement(3664241..3665383)
AA seq 380 aa
MKKLKVMTVFGTRPEAIKMAPLVLELKKYPEIDSYVTVTAQHRQMLDQVLDAFHIKPDFD
LNIMKERQTLAEITSNALVRLDELFKDIKPDIVLVHGDTTTTFAGSLAAFYHQIAVGHVE
AGLRTGNKYSPFPEELNRQMTGAIADLHFAPTGQAKDNLLKENKKADSIFVTGNTAIDAL
NTTVRDGYSHPVLDQVGEDKMILLTAHRRENLGEPMENMFKAIRRIVGEFEDVQVVYPVH
LNPVVREAAHKHFGDSDRVHLIEPLEVIDFHNFAAKSHFILTDSGGVQEEAPSLGKPVLV
LRDTTERPEGVEAGTLKLAGTDEENIYQLAKQLLTDPDEYKKMSQASNPYGDGEASRRIV
EELLFHYGYRKEQPDSFTGK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaaaaaactaaaagtgatgaccgttttcgggaccaggcctgaagcgatcaagatggca
ccgcttgtgcttgaattgaaaaaatatcctgaaatagattcctatgtaacggtaactgca
cagcacagacagatgctcgatcaggtgttagatgcgtttcacatcaagcctgacttcgat
ttgaacattatgaaggagcggcagacactggcagagattacgtctaacgcacttgtaaga
ttggatgagttgtttaaagatatcaaacccgatattgtgcttgtccatggtgatacgacg
acgacgtttgccggaagcctagccgctttttaccatcaaattgctgtcggtcatgtggag
gcggggctccgtacagggaataagtattccccgtttccggaagagctcaatcgacagatg
acaggggcgattgctgatttgcattttgctccgacaggccaggcgaaagacaatttatta
aaagaaaacaaaaaggccgactctatttttgtaacgggcaatacagcgattgacgcactc
aacacaacggttagggatggttactcacatcctgttctcgatcaggtgggtgaggataaa
atgattctcttgaccgctcaccgccgggaaaatttgggtgagccaatggaaaacatgttt
aaggccatccgcagaattgtaggggaatttgaagatgtacaagtcgtttaccctgtgcac
ctgaatcctgttgtccgggaagcggctcataagcattttggtgattctgacagagtgcat
ctgattgaacctttagaggtgatcgatttccataactttgcagcgaaatcgcattttata
ttgaccgattcgggcggcgtgcaggaggaagccccatctctcgggaaaccggttcttgtt
ctgcgtgatacgacggaacggcctgaaggagtggaagcgggaacgctgaaacttgcaggt
acggatgaggaaaacatttatcagcttgcaaaacagctgttaactgatcctgatgagtac
aagaaaatgtcccaggcttctaatccgtatggagatggagaggcttcccgccggattgtg
gaagaattgctgtttcattacgggtatcgaaaagaacaaccggattcatttacaggcaaa
taa

DBGET integrated database retrieval system